Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA26313_WB6.jpg WB (Western Blot) (Western Blot analysis of TRIM28 expression in transfected 293T cell line by TRIM28 monoclonal antibody (M02), clone 1D11.Lane 1: TRIM28 transfected lysate (Predicted MW: 88.5 KDa).Lane 2: Non-transfected lysate.)

Mouse TRIM28 Monoclonal Antibody | anti-TRIM28 antibody

TRIM28 (Tripartite Motif-Containing 28, FLJ29029, KAP1, RNF96, TF1B, TIF1B) (FITC)

Gene Names
TRIM28; KAP1; TF1B; RNF96; TIF1B; PPP1R157
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
TRIM28, Antibody; TRIM28 (Tripartite Motif-Containing 28, FLJ29029, KAP1, RNF96, TF1B, TIF1B) (FITC); Tripartite Motif-Containing 28; FLJ29029; KAP1; RNF96; TF1B; TIF1B; anti-TRIM28 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D11
Specificity
Recognizes TRIM28.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
835
Applicable Applications for anti-TRIM28 antibody
ELISA, IHC (Immunohistochemistry), WB (Western Blot)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
TRIM28 (AAH04978, 379aa-524aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IVDPVEPHGEMKFQWDLNAWTKSAEAFGKIVAERPGTNSTGPAPMAPPRAPGPLSKQGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVKRSRSGEGEVSGLMRKVPRVSLERLDLDLTADSQPPVFKVFPGSTTEDYNLIVIER
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

WB (Western Blot)

(Western Blot analysis of TRIM28 expression in transfected 293T cell line by TRIM28 monoclonal antibody (M02), clone 1D11.Lane 1: TRIM28 transfected lysate (Predicted MW: 88.5 KDa).Lane 2: Non-transfected lysate.)

product-image-AAA26313_WB6.jpg WB (Western Blot) (Western Blot analysis of TRIM28 expression in transfected 293T cell line by TRIM28 monoclonal antibody (M02), clone 1D11.Lane 1: TRIM28 transfected lysate (Predicted MW: 88.5 KDa).Lane 2: Non-transfected lysate.)

WB (Western Blot)

(TRIM28 monoclonal antibody (M02), clone 1D11. Western Blot analysis of TRIM28 expression in MCF-7.)

product-image-AAA26313_WB5.jpg WB (Western Blot) (TRIM28 monoclonal antibody (M02), clone 1D11. Western Blot analysis of TRIM28 expression in MCF-7.)

WB (Western Blot)

(TRIM28 monoclonal antibody (M02), clone 1D11. Western Blot analysis of TRIM28 expression in PC-12 (Cat # L012V1).)

product-image-AAA26313_WB4.jpg WB (Western Blot) (TRIM28 monoclonal antibody (M02), clone 1D11. Western Blot analysis of TRIM28 expression in PC-12 (Cat # L012V1).)

WB (Western Blot)

(TRIM28 monoclonal antibody (M02), clone 1D11. Western Blot analysis of TRIM28 expression in NIH/3T3 (Cat # L018V1).)

product-image-AAA26313_WB3.jpg WB (Western Blot) (TRIM28 monoclonal antibody (M02), clone 1D11. Western Blot analysis of TRIM28 expression in NIH/3T3 (Cat # L018V1).)

IHC (Immunohistochemistry)

(Immunoperoxidase of monoclonal antibody to TRIM28 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml])

product-image-AAA26313_IHC2.jpg IHC (Immunohistochemistry) (Immunoperoxidase of monoclonal antibody to TRIM28 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml])

Application Data

(Immunoperoxidase of monoclonal antibody to TRIM28 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml])

product-image-AAA26313_APP.jpg Application Data (Immunoperoxidase of monoclonal antibody to TRIM28 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml])
Related Product Information for anti-TRIM28 antibody
The protein encoded by this gene mediates transcriptional control by interaction with the Kruppel-associated box repression domain found in many transcription factors. The protein localizes to the nucleus and is thought to associate with specific chromatin regions. The protein is a member of the tripartite motif family. This tripartite motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. [provided by RefSeq]
Product Categories/Family for anti-TRIM28 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Tripartite motif-containing 28
NCBI Official Synonym Full Names
tripartite motif containing 28
NCBI Official Symbol
TRIM28
NCBI Official Synonym Symbols
KAP1; TF1B; RNF96; TIF1B; PPP1R157
NCBI Protein Information
transcription intermediary factor 1-beta

Similar Products

Product Notes

The TRIM28 (Catalog #AAA26313) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's TRIM28 can be used in a range of immunoassay formats including, but not limited to, ELISA, IHC (Immunohistochemistry), WB (Western Blot). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the TRIM28 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRIM28, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.