Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28497_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using XPD/ERCC2 Rabbit mAb (AAA28497) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

Rabbit anti-Human XPD/ERCC2 Monoclonal Antibody | anti-ERCC2 antibody

XPD/ERCC2 Rabbit mAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Western Blot, Immunohistochemistry, ELISA
Purity
Affinity purification
Synonyms
XPD/ERCC2, Antibody; XPD/ERCC2 Rabbit mAb; EM9; TTD; XPD; TTD1; COFS2; TFIIH; XPD/ERCC2; anti-ERCC2 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Sequence
ARGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEH
Applicable Applications for anti-ERCC2 antibody
WB (Western Blot), IHC (Immunohistochemistry), ELISA
Application Notes
WB: 1:500-1:1000
IHC-P: 1:50-1:200
ELISA: Recommended starting concentration is 1ug/mL.
Please optimize the concentration based on your specific assay requirements.
Cross Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 600-700 of human XPD/ERCC2 (P18074).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistchemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using XPD/ERCC2 Rabbit mAb (AAA28497) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28497_IHC6.jpg IHC (Immunohistchemistry) (Immunohistochemistry analysis of paraffin-embedded Human colon carcinoma tissue using XPD/ERCC2 Rabbit mAb (AAA28497) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using XPD/ERCC2 Rabbit mAb (AAA28497) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28497_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using XPD/ERCC2 Rabbit mAb (AAA28497) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using XPD/ERCC2 Rabbit mAb (AAA28497) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28497_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using XPD/ERCC2 Rabbit mAb (AAA28497) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human colon tissue using XPD/ERCC2 Rabbit mAb (AAA28497) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28497_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human colon tissue using XPD/ERCC2 Rabbit mAb (AAA28497) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using XPD/ERCC2 Rabbit mAb (AAA28497) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

product-image-AAA28497_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry analysis of paraffin-embedded Human cervix cancer tissue using XPD/ERCC2 Rabbit mAb (AAA28497) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M Tris-EDTA buffer (pH 9.0) prior to IHC staining.)

WB (Western Blot)

(Western blot analysis of various lysates using XPD/ERCC2 Rabbit mAb (AAA28497) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)

product-image-AAA28497_WB.jpg WB (Western Blot) (Western blot analysis of various lysates using XPD/ERCC2 Rabbit mAb (AAA28497) at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 10s.)
Related Product Information for anti-ERCC2 antibody
The nucleotide excision repair pathway is a mechanism to repair damage to DNA. The protein encoded by this gene is involved in transcription-coupled nucleotide excision repair and is an integral member of the basal transcription factor BTF2/TFIIH complex. The gene product has ATP-dependent DNA helicase activity and belongs to the RAD3/XPD subfamily of helicases. Defects in this gene can result in three different disorders, the cancer-prone syndrome xeroderma pigmentosum complementation group D, trichothiodystrophy, and Cockayne syndrome. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated MW: 87kDa
Observed MW: 80kDa
UniProt Protein Name
TFIIH basal transcription factor complex helicase XPD subunit
UniProt Gene Name
ERCC2
UniProt Synonym Gene Names
XPD; XPDC; BTF2 p80; TFIIH 80 kDa subunit; TFIIH p80
UniProt Entry Name
ERCC2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ERCC2 ercc2 (Catalog #AAA28497) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The XPD/ERCC2 Rabbit mAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's XPD/ERCC2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), ELISA. WB: 1:500-1:1000 IHC-P: 1:50-1:200 ELISA: Recommended starting concentration is 1ug/mL. Please optimize the concentration based on your specific assay requirements. Researchers should empirically determine the suitability of the ERCC2 ercc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ARGKVSEGID FVHHYGRAVI MFGVPYVYTQ SRILKARLEY LRDQFQIREN DFLTFDAMRH AAQCVGRAIR GKTDYGLMVF ADKRFARGDK RGKLPRWIQE H. It is sometimes possible for the material contained within the vial of "XPD/ERCC2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.