Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online
product-image-AAA25931_APP6.jpg Application Data

Mouse YAP1 Monoclonal Antibody | anti-YAP1 antibody

YAP1 (Yes-Associated Protein 1, 65kD, YAP, YAP2, YAP65, YKI) (AP)

Gene Names
YAP1; YAP; YKI; COB1; YAP2; YAP65
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
YAP1, Antibody; YAP1 (Yes-Associated Protein 1, 65kD, YAP, YAP2, YAP65, YKI) (AP); Yes-Associated Protein 1; 65kD; YAP; YAP2; YAP65; YKI; anti-YAP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2H1
Specificity
Recognizes human YAP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
450
Applicable Applications for anti-YAP1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa53-161 from human YAP1. MW of the GST tag alone is 26kD.
Immunogen Sequence
QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Application Data

product-image-AAA25931_APP6.jpg Application Data

Application Data

product-image-AAA25931_APP5.jpg Application Data

Application Data

product-image-AAA25931_APP4.jpg Application Data

IHC (Immunohistochemistry)

(Immunoperoxidase of formalin-fixed paraffin-embedded human placenta using 253500 (3ug/ml.)

product-image-AAA25931_IHC3.jpg IHC (Immunohistochemistry) (Immunoperoxidase of formalin-fixed paraffin-embedded human placenta using 253500 (3ug/ml.)

WB (Western Blot)

(Western Blot analysis of YAP1 expression in Hela S3 NE using 253500.)

product-image-AAA25931_WB2.jpg WB (Western Blot) (Western Blot analysis of YAP1 expression in Hela S3 NE using 253500.)

Application Data

(Detection limit for recombinant GST tagged YAP1 is approximately 0.03ng/ml using 253500 as a capture antibody.)

product-image-AAA25931_APP.jpg Application Data (Detection limit for recombinant GST tagged YAP1 is approximately 0.03ng/ml using 253500 as a capture antibody.)
Product Categories/Family for anti-YAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
transcriptional coactivator YAP1 isoform 2
NCBI Official Synonym Full Names
Yes1 associated transcriptional regulator
NCBI Official Symbol
YAP1
NCBI Official Synonym Symbols
YAP; YKI; COB1; YAP2; YAP65
NCBI Protein Information
transcriptional coactivator YAP1

Similar Products

Product Notes

The YAP1 (Catalog #AAA25931) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's YAP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the YAP1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "YAP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.