YAP1 / Transcriptional Coactivator YAP1 Recombinant Protein | YAP1 recombinant protein
Transcriptional coactivator YAP1
Gene Names
YAP1; YAP; YKI; COB1; YAP2; YAP65
Applications
Western Blot, ELISA
Purity
>90%
Synonyms
YAP1 / Transcriptional Coactivator YAP1; N/A; Transcriptional coactivator YAP1; Yes-associated protein 1; Protein yorkie homolog; Yes-associated protein YAP65 homolog; YAP65; YAP1 recombinant protein
Host
E. coli
Purity/Purification
>90%
Form/Format
50mM NaH2PO4, 500mM NaCl Buffer with 500mM Imidazole, 10% glycerol(PH8.0)
Concentration
1mg/mL (varies by lot)
Sequence
DPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDS
Applicable Applications for YAP1 recombinant protein
WB (Western Blot), ELISA
Organism
Homo sapiens(human)
Protein Accession
P46937 (201-400aa)
Preparation and Storage
Store at -20°C. (Avoid repeated freezing and thawing.)
Related Product Information for YAP1 recombinant protein
Recombinant protein with His-tag
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
22KD
NCBI Official Full Name
transcriptional coactivator YAP1 isoform 1
NCBI Official Synonym Full Names
Yes associated protein 1
NCBI Official Symbol
YAP1
NCBI Official Synonym Symbols
YAP; YKI; COB1; YAP2; YAP65
NCBI Protein Information
transcriptional coactivator YAP1
UniProt Protein Name
Yorkie homolog
UniProt Gene Name
YAP1
UniProt Synonym Gene Names
YAP65; YAP65
UniProt Entry Name
YAP1_HUMAN
Similar Products
Product Notes
The YAP1 yap1 (Catalog #AAA196940) is a Recombinant Protein produced from E. coli and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's YAP1 / Transcriptional Coactivator YAP1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), ELISA. Researchers should empirically determine the suitability of the YAP1 yap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DPRKAMLSQM NVTAPTSPPV QQNMMNSASG PLPDGWEQAM TQDGEIYYIN HKNKTTSWLD PRLDPRFAMN QRISQSAPVK QPPPLAPQSP QGGVMGGSNS NQQQQMRLQQ LQMEKERLRL KQQELLRAMR NINPSTANSP KCQELALRSQ LPTLEQDGGT QNPVSSPGMS QELRTMTTNS SDPFLNSGTY HSRDESTDS. It is sometimes possible for the material contained within the vial of "YAP1 / Transcriptional Coactivator YAP1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
