Mouse YAP1 Monoclonal Antibody | anti-YAP1 antibody

YAP1 (Yes-Associated Protein 1, 65kD, YAP, YAP2, YAP65, YKI) (FITC)

Cat. Num. AAA26330

• Gene Names: YAP1; YAP; YKI; COB1; YAP2; YAP65
• Applications: Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified
• Synonyms: YAP1, Antibody; YAP1 (Yes-Associated Protein 1, 65kD, YAP, YAP2, YAP65, YKI) (FITC); Yes-Associated Protein 1; 65kD; YAP; YAP2; YAP65; YKI; anti-YAP1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2H1
• Specificity: Recognizes human YAP1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 450

• Applicable Applications for anti-YAP1 antibody: FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa53-161 from human YAP1. MW of the GST tag alone is 26kD.
• Immunogen Sequence: QIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEPKSHSRQASTDAGTAGALTPQHVRAHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.; ; FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Application Data

Application Data

IF (Immunofluorescence)

(Immunofluorescence of HeLa cell using (40g/ml).)

IHC (Immunohistochemistry)

(Immunoperoxidase of formalin-fixed paraffin-embedded human placenta using (3ug/ml.)

WB (Western Blot)

(Western Blot analysis of YAP1 expression in Hela S3 NE using.)

Application Data

(Detection limit for recombinant GST tagged YAP1 is approximately 0.03ng/ml using as a capture antibody.)

Product Categories/Family for anti-YAP1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 303523511
• NCBI GeneID: 10413
• NCBI Accession #: NP_006097
• NCBI GenBank Nucleotide #: NP_006097.2
• NCBI Official Full Name: transcriptional coactivator YAP1 isoform 2
• NCBI Official Synonym Full Names: Yes1 associated transcriptional regulator
• NCBI Official Symbol: YAP1
• NCBI Official Synonym Symbols: YAP; YKI; COB1; YAP2; YAP65
• NCBI Protein Information: transcriptional coactivator YAP1