Nephrin Recombinant Protein | NPHS1 recombinant protein
Recombinant Human Nephrin
Gene Names
NPHS1; CNF; NPHN; nephrin
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Nephrin; N/A; Recombinant Human Nephrin; Renal glomerulus-specific cell adhesion receptor; NPHS1 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-257aa; Partial
Sequence
QLAIPASVPRGFWALPENLTVVEGASVELRCGVSTPGSAVQWAKDGLLLGPDPRIPGFPRYRLEGDPARGEFHLHIEACDLSDDAEYECQVGRSEMGPELVSPRVILSILVPPKLLLLTPEAGTMVTWVAGQEYVVNCVSGDAKPAPDITILLSGQTISDISANVNEGSQQKLFTVEATARVTPRSSDNRQLLVCEASSPALEAPIKASFTVNVLFPPGPPVIEWPGLDEGHVRA
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our or email to for more details.
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
Related Product Information for NPHS1 recombinant protein
Ses to play a role in the development or function of the kidney glomerular filtration barrier. Regulates glomerular vascular permeability. May anchor the podocyte slit diaphragm to the actin cytoskeleton. Plays a role in skeletal muscle formation through regulation of myoblast fusion.
Product Categories/Family for NPHS1 recombinant protein
References
Positionally cloned gene for a novel glomerular protein -- nephrin --is mutated in congenital nephrotic syndrome.Kestilae M., Lenkkeri U., Maennikkoe M., Lamerdin J.E., McCready P., Putaala H., Ruotsalainen V., Morita T., Nissinen M., Herva R., Kashtan C.E., Peltonen L., Holmberg C., Olsen A., Tryggvason K.Mol. Cell 1:575-582(1998) Novel human pathological mutations. Gene symbol NPHS1. Disease congenital nephrotic syndrome, Finnish type.Tikhomirov E., Voznesenskaya T., Tsygin A.Hum. Genet. 125:334-334(2009) Human nephrin (NPHS1) cDNA sequence.Grunkemeyer J.A., Kumar N., Kalluri R.The DNA sequence and biology of human chromosome 19.Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V., Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.Nature 428:529-535(2004) Nephrin localizes at the podocyte filtration slit area and is characteristically spliced in the human kidney.Holthoefer H., Ahola H., Solin M.-L., Wang S.-X., Palmen T., Luimula P., Miettinen A., Kerjaschki D.Am. J. Pathol. 155:1681-1687(1999) Nephrin is specifically located at the slit diaphragm of glomerular podocytes.Ruotsalainen V., Ljungberg P., Wartiovaara J., Lenkkeri U., Kestilae M., Jalanko H., Holmberg C., Tryggvason K.Proc. Natl. Acad. Sci. U.S.A. 96:7962-7967(1999) Interaction with podocin facilitates nephrin signaling.Huber T.B., Kottgen M., Schilling B., Walz G., Benzing T.J. Biol. Chem. 276:41543-41546(2001) Phosphoproteome of resting human platelets.Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A.J. Proteome Res. 7:526-534(2008) Structure of the gene for congenital nephrotic syndrome of the Finnish type (NPHS1) and characterization of mutations.Lenkkeri U., Maennikkoe M., McCready P., Lamerdin J., Gribouval O., Niaudet P.M., Antignac C.K., Kashtan C.E., Homberg C., Olsen A., Kestilae M., Tryggvason K.Am. J. Hum. Genet. 64:51-61(1999) Novel mutation in the nephrin gene of a Japanese patient with congenital nephrotic syndrome of the Finnish type.Aya K., Tanaka H., Seino Y.Kidney Int. 57:401-404(2000) Defective nephrin trafficking caused by missense mutations in the NPHS1 gene insight into the mechanisms of congenital nephrotic syndrome.Liu L., Done S.C., Khoshnoodi J., Bertorello A., Wartiovaara J., Berggren P.O., Tryggvason K.Hum. Mol. Genet. 10:2637-2644(2001) Mutation spectrum in the nephrin gene (NPHS1) in congenital nephrotic syndrome.Beltcheva O., Martin P., Lenkkeri U., Tryggvason K.Hum. Mutat. 17:368-373(2001) A familial childhood-onset relapsing nephrotic syndrome.Kitamura A., Tsukaguchi H., Hiramoto R., Shono A., Doi T., Kagami S., Iijima K.Kidney Int. 71:946-951(2007) Nephrin mutations can cause childhood-onset steroid-resistant nephrotic syndrome.Philippe A., Nevo F., Esquivel E.L., Reklaityte D., Gribouval O., Tete M.J., Loirat C., Dantal J., Fischbach M., Pouteil-Noble C., Decramer S., Hoehne M., Benzing T., Charbit M., Niaudet P., Antignac C.J. Am. Soc. Nephrol. 19:1871-1878(2008) Thirteen novel NPHS1 mutations in a large cohort of children with congenital nephrotic syndrome.Heeringa S.F., Vlangos C.N., Chernin G., Hinkes B., Gbadegesin R., Liu J., Hoskins B.E., Ozaltin F., Hildebrandt F.Nephrol. Dial. Transplant. 23:3527-3533(2008) Nineteen novel NPHS1 mutations in a worldwide cohort of patients with congenital nephrotic syndrome (CNS) .Schoeb D.S., Chernin G., Heeringa S.F., Matejas V., Held S., Vega-Warner V., Bockenhauer D., Vlangos C.N., Moorani K.N., Neuhaus T.J., Kari J.A., MacDonald J., Saisawat P., Ashraf S., Ovunc B., Zenker M., Hildebrandt F.Nephrol. Dial. Transplant. 25:2970-2976(2010) Two novel NPHS1 mutations in a Chinese family with congenital nephrotic syndrome.Wu L.Q., Hu J.J., Xue J.J., Liang D.S.Genet. Mol. Res. 10:2517-2522(2011) A spectrum of novel NPHS1 and NPHS2 gene mutations in pediatric nephrotic syndrome patients from Pakistan.Abid A., Khaliq S., Shahid S., Lanewala A., Mubarak M., Hashmi S., Kazi J., Masood T., Hafeez F., Naqvi S.A., Rizvi S.A., Mehdi S.Q.Gene 502:133-137(2012)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27.5 kDa
NCBI Official Full Name
nephrin
NCBI Official Synonym Full Names
NPHS1 nephrin
NCBI Official Symbol
NPHS1
NCBI Official Synonym Symbols
CNF; NPHN; nephrin
NCBI Protein Information
nephrin
UniProt Protein Name
Nephrin
UniProt Gene Name
NPHS1
UniProt Synonym Gene Names
NPHN
UniProt Entry Name
NPHN_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The NPHS1 nphs1 (Catalog #AAA116086) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-257aa; Partial. The amino acid sequence is listed below: QLAIPASVPR GFWALPENLT VVEGASVELR CGVSTPGSAV QWAKDGLLLG PDPRIPGFPR YRLEGDPARG EFHLHIEACD LSDDAEYECQ VGRSEMGPEL VSPRVILSIL VPPKLLLLTP EAGTMVTWVA GQEYVVNCVS GDAKPAPDIT ILLSGQTISD ISANVNEGSQ QKLFTVEATA RVTPRSSDNR QLLVCEASSP ALEAPIKASF TVNVLFPPGP PVIEWPGLDE GHVRA. It is sometimes possible for the material contained within the vial of "Nephrin, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
