Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA79136_AD15.jpg Application Data (SDS-PAGE analysis of recombinant human soluble Podoplanin. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Silver stain.)

Podoplanin, soluble Recombinant Protein | PDPN recombinant protein

Human Podoplanin, soluble

Gene Names
PDPN; T1A; GP36; GP40; Gp38; OTS8; T1A2; TI1A; T1A-2; AGGRUS; HT1A-1; PA2.26
Reactivity
Human
Purity
> 95% by SDS-PAGE & silver stain
Synonyms
Podoplanin, soluble; N/A; Human Podoplanin, soluble; Recombinant Human soluble Podoplanin; GP36; Glycoprotein 36; Aggrus; T1-alpha; PDPN recombinant protein
Ordering
Host
E Coli
Reactivity
Human
Purity/Purification
> 95% by SDS-PAGE & silver stain
Form/Format
Lyophilized
Sequence
GSSHHHHHHSSGLVPRGSHMEGASTGQPEDDTETTGLEGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLST
Sequence Length
127
N Terminal Sequence
GSHMEGASTGQ
Buffer
PBS
Length (aa)
127
Stabilizer
None
Reconstitution
We recommend a quick spin followed by reconstitution in water to a concentration of 0.1 - 1.0 mg/ml. This solution can then be diluted into other aqueous buffers and stored at 4°C for 1 week or -20°C for future use.
Preparation and Storage
The lyophilized protein is stable for a few weeks at room temperature, but best stored at -20 degree C. Reconstituted sPodoplanin should be stored in working aliquots at -20 degree C.

Application Data

(SDS-PAGE analysis of recombinant human soluble Podoplanin. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Silver stain.)

product-image-AAA79136_AD15.jpg Application Data (SDS-PAGE analysis of recombinant human soluble Podoplanin. Sample was loaded in 15% SDS-polyacrylamide gel under reducing conditions and stained with Silver stain.)
Related Product Information for PDPN recombinant protein
Podoplanin, also known as glycoprotein 36 (gp36), PA2.26 antigen, T1-alpha (T1A), and aggrus, is a 36 kDa type I transmembrane sialoglycoprotein and member of the Podoplanin family. Podoplanin has three potential splice variants, the longest of which is represented by a 238 amino acid precursor (NP_006465). It contains an undefined signal sequence, a 22 aa transmembrane segment (aa 207-228) and a short cytoplasmic tail (aa 229-238). The ECD contains abundant Ser/Thr residues that could serve as potential O-linked glycosylation sites. The cytoplasmic tail contains putative sites for protein kinase C phosphorylation. There are two potential alternate start sites at Met 77 (Swiss Prot #: Q86YL7) and Met 119 (EAW51692) that generate short forms. The 162 aa short form Podoplanin precursor shares 47% aa identity with mouse Podoplanin. Podoplanin is expressed on glomerular epithelial cells (podocytes), type I lung alveolar cells, lymphatic endothelial cells, and numerous tumors, including colorectal tumors, squamous cell carcinomas, testicular seminoma, and brain tumors. One study shows high expression of Podoplanin mRNA in placenta, lung, skeletal muscle, and heart, and weaker levels in brain, kidney, and liver. Podoplanin is the ligand for C-type lectin-like receptor 2 (CLEC-2). Their association is dependent on sialic acid on O-glycans of Podoplanin. Through its association with CLEC-2, Podoplanin induces platelet aggregation and tumor metastasis. Podoplanin is also necessary for lymphatic vessel formation, normal lung cell proliferation and alveolus formation at birth. The recombinant soluble Podoplanin starts with GLST and ends with GLST.
Product Categories/Family for PDPN recombinant protein
References
1. Breiteneder-Geleff et al, Am J Pathol 154:385, 1999 2. Kerjaschki et al, Nature Med 12:230, 2006 3. Kriehuber et al, J Exp Med 194:797, 2001 4. Zimmer. et al, Biochem J 341:277, 1999 5. Kato et al, Tumour Biol 26:195, 2005 6. Katsue-Inoue et al, J Biol Chem 282:25993, 2007 7. Kato et al, Oncogene 23:8552, 2004 8. Schacht. et al, Am J Pathol 166:913, 2005 9. Mishima et al, Acta Neuropathol 111:483, 2006

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,1 kDa
NCBI Official Full Name
podoplanin isoform c
NCBI Official Synonym Full Names
podoplanin
NCBI Official Symbol
PDPN
NCBI Official Synonym Symbols
T1A; GP36; GP40; Gp38; OTS8; T1A2; TI1A; T1A-2; AGGRUS; HT1A-1; PA2.26
NCBI Protein Information
podoplanin; T1-alpha; hT1alpha-1; hT1alpha-2; PA2.26 antigen; glycoprotein 36; glycoprotein, 36-KD; lung type I cell membrane associated glycoprotein; lung type-I cell membrane-associated glycoprotein (T1A-2)
UniProt Protein Name
Podoplanin
UniProt Gene Name
PDPN
UniProt Synonym Gene Names
GP36; Gp36; T1A
UniProt Entry Name
PDPN_HUMAN

Similar Products

Product Notes

The PDPN pdpn (Catalog #AAA79136) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The Human Podoplanin, soluble reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: GSSHHHHHHS SGLVPRGSHM EGASTGQPED DTETTGLEGV AMPGAEDDVV TPGTSEDRYK SGLTTLVATS VNSVTGIRIE DLPTSESTVH AQEQSPSATA SNVATSHSTE KVDGDTQTTV EKDGLST. It is sometimes possible for the material contained within the vial of "Podoplanin, soluble, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.