Rabbit A730011L01Rik Polyclonal Antibody | anti-ENDOV antibody
A730011L01Rik antibody - middle region
Gene Names
Endov; A730011L01Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
A730011L01Rik, Antibody; A730011L01Rik antibody - middle region; anti-ENDOV antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VACHLGVLTELPCIGVAKKLLQVDGLENNALHKEKIVLLQAGGDTFPLIG
Sequence Length
338
Applicable Applications for anti-ENDOV antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 77%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-ENDOV antibody
This is a rabbit polyclonal antibody against A730011L01Rik. It was validated on Western Blot
Target Description: A730011L01Rik selectively cleaves DNA at the second phosphodiester bond 3' to hypoxanthine- and uracil-containing nucleotides. It shows higher activity towards single-stranded than double-stranded DNA and towards hypoxanthine than uracil..
Target Description: A730011L01Rik selectively cleaves DNA at the second phosphodiester bond 3' to hypoxanthine- and uracil-containing nucleotides. It shows higher activity towards single-stranded than double-stranded DNA and towards hypoxanthine than uracil..
Product Categories/Family for anti-ENDOV antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
endonuclease V isoform 1
NCBI Official Synonym Full Names
endonuclease V
NCBI Official Symbol
Endov
NCBI Official Synonym Symbols
A730011L01Rik
NCBI Protein Information
endonuclease V
UniProt Protein Name
Endonuclease V
UniProt Gene Name
Endov
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The ENDOV endov (Catalog #AAA200519) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The A730011L01Rik antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's A730011L01Rik can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ENDOV endov for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VACHLGVLTE LPCIGVAKKL LQVDGLENNA LHKEKIVLLQ AGGDTFPLIG. It is sometimes possible for the material contained within the vial of "A730011L01Rik, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
