Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200151_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry with Human Adrenal tissue)

Rabbit ABCB1 Polyclonal Antibody | anti-ABCB1 antibody

ABCB1 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ABCB1; CLCS; MDR1; P-GP; PGY1; ABC20; CD243; GP170
Reactivity
Tested Reactivity: Human (Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish)
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ABCB1, Antibody; ABCB1 antibody - middle region; anti-ABCB1 antibody
Ordering
Host
Rabbit
Reactivity
Tested Reactivity: Human (Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish)
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range : 100ul at 0.5-1mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: AIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTQ
Sequence Length
1280
Applicable Applications for anti-ABCB1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Replacement Item
This antibody may replace item sc-1517, HPA002199
Blocking Peptide
For anti-ABCB1 (MBS3210312) antibody is Catalog # MBS3235268
Protein Size
1280 amino acids
Protein Interactions
FBXO15; UBA7; UBC; MAPKAP1; BCCIP; CD4; LNX1; PSMB8; PIM1; DHX9; HAX1; RNF2; CAV1;
Replacement Item
This antibody may replace item sc-1517, HPA002199
Additional Information
IHC Information: Placenta
IHC Information: Adrenal
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry with Human Adrenal tissue)

product-image-AAA200151_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry with Human Adrenal tissue)

IHC (Immunohistochemistry)

(Immunohistochemistry with Human Placenta tissue)

product-image-AAA200151_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Human Placenta tissue)
Related Product Information for anti-ABCB1 antibody
This is a rabbit polyclonal antibody against ABCB1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct
Product Categories/Family for anti-ABCB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
141kDa
NCBI Official Full Name
multidrug resistance protein 1 isoform 2
NCBI Official Synonym Full Names
ATP binding cassette subfamily B member 1
NCBI Official Symbol
ABCB1
NCBI Official Synonym Symbols
CLCS; MDR1; P-GP; PGY1; ABC20; CD243; GP170
NCBI Protein Information
multidrug resistance protein 1
UniProt Protein Name
Multidrug resistance protein 1
UniProt Gene Name
ABCB1
UniProt Synonym Gene Names
MDR1; PGY1
UniProt Entry Name
MDR1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ABCB1 abcb1 (Catalog #AAA200151) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ABCB1 antibody - middle region reacts with Tested Reactivity: Human (Predicted Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish) and may cross-react with other species as described in the data sheet. AAA Biotech's ABCB1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ABCB1 abcb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AIVPIIAIAG VVEMKMLSGQ ALKDKKELEG SGKIATEAIE NFRTVVSLTQ. It is sometimes possible for the material contained within the vial of "ABCB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.