Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA200371_WB13.jpg WB (Western Blot) (WB Suggested Anti-ACADVL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: ACHN cell lysateACADVL is supported by BioGPS gene expression data to be expressed in ACHN)

Rabbit ACADVL Polyclonal Antibody | anti-ACADVL antibody

ACADVL antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
ACADVL; ACAD6; LCACD; VLCAD
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ACADVL, Antibody; ACADVL antibody - C-terminal region; anti-ACADVL antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IDLYAMVVVLSRASRSLSEGHPTAQHEKMLCDTWCIEAAARIREGMAALQ
Sequence Length
633
Applicable Applications for anti-ACADVL antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 79%; Rat: 93%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human ACADVL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ACADVL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: ACHN cell lysateACADVL is supported by BioGPS gene expression data to be expressed in ACHN)

product-image-AAA200371_WB13.jpg WB (Western Blot) (WB Suggested Anti-ACADVL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: ACHN cell lysateACADVL is supported by BioGPS gene expression data to be expressed in ACHN)

WB (Western Blot)

(Lanes:1: Normal controls Normal enzyme expression2: Normal controls Normal enzyme expression3: Positive mutants Defective enzyme expression4: Positive mutants Defective enzyme expression5: Positive mutants Defective enzyme expressionPrimary Antibody Dilution:1:2000Secondary Antibody:Secondary Antibody Dilution:1:1000Gene Name:ACADVLSubmitted by:David Lombert, Medical College of Wisconsin)

product-image-AAA200371_WB15.jpg WB (Western Blot) (Lanes:1: Normal controls Normal enzyme expression2: Normal controls Normal enzyme expression3: Positive mutants Defective enzyme expression4: Positive mutants Defective enzyme expression5: Positive mutants Defective enzyme expressionPrimary Antibody Dilution:1:2000Secondary Antibody:Secondary Antibody Dilution:1:1000Gene Name:ACADVLSubmitted by:David Lombert, Medical College of Wisconsin)
Related Product Information for anti-ACADVL antibody
This is a rabbit polyclonal antibody against ACADVL. It was validated on Western Blot

Target Description: ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
37
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
very long-chain specific acyl-CoA dehydrogenase, mitochondrial isoform 2
NCBI Official Synonym Full Names
acyl-CoA dehydrogenase very long chain
NCBI Official Symbol
ACADVL
NCBI Official Synonym Symbols
ACAD6; LCACD; VLCAD
NCBI Protein Information
very long-chain specific acyl-CoA dehydrogenase, mitochondrial
UniProt Protein Name
Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
UniProt Gene Name
ACADVL
UniProt Synonym Gene Names
VLCAD; VLCAD
UniProt Entry Name
ACADV_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ACADVL acadvl (Catalog #AAA200371) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACADVL antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ACADVL can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ACADVL acadvl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IDLYAMVVVL SRASRSLSEG HPTAQHEKML CDTWCIEAAA RIREGMAALQ. It is sometimes possible for the material contained within the vial of "ACADVL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.