WB (Western Blot)
(WB Suggested Anti-ACTR3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)
Rabbit ACTR3 Polyclonal Antibody | anti-ACTR3 antibody
ACTR3 Antibody - N-terminal region
Gene Names
ACTR3; ARP3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ACTR3, Antibody; ACTR3 Antibody - N-terminal region; anti-ACTR3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIEKPTYATKWPIRHGIVE
Sequence Length
418
Applicable Applications for anti-ACTR3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ACTR3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-ACTR3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)
WB (Western Blot)
(WB Suggested Anti-ACTR3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)
IHC (Immunohistochemistry)
(Rabbit Anti-ACTR3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: Cytoplasm in Leydig cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
IHC (Immunohistochemistry)
(Rabbit Anti-ACTR3 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: Cytoplasm in Leydig cellsPrimary Antibody Concentration: 1:100Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-ACTR3 antibody
This is a rabbit polyclonal antibody against ACTR3. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. Three transcript variants encoding two different isoforms have been found for this gene.
Target Description: The specific function of this gene has not yet been determined; however, the protein it encodes is known to be a major constituent of the ARP2/3 complex. This complex is located at the cell surface and is essential to cell shape and motility through lamellipodial actin assembly and protrusion. Three transcript variants encoding two different isoforms have been found for this gene.
Product Categories/Family for anti-ACTR3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
actin-related protein 3 isoform 1
NCBI Official Synonym Full Names
actin related protein 3
NCBI Official Symbol
ACTR3
NCBI Official Synonym Symbols
ARP3
NCBI Protein Information
actin-related protein 3
UniProt Protein Name
Actin-related protein 3
UniProt Gene Name
ACTR3
UniProt Synonym Gene Names
ARP3
UniProt Entry Name
ARP3_HUMAN
Similar Products
Product Notes
The ACTR3 actr3 (Catalog #AAA200210) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ACTR3 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ACTR3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ACTR3 actr3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IAIKESAKVG DQAQRRVMKG VDDLDFFIGD EAIEKPTYAT KWPIRHGIVE. It is sometimes possible for the material contained within the vial of "ACTR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.