Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201483_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: AIPL1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

Rabbit anti-Human AIPL1 Polyclonal Antibody | anti-AIPL1 antibody

AIPL1 Antibody - C-terminal region

Gene Names
AIPL1; LCA4; AIPL2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AIPL1, Antibody; AIPL1 Antibody - C-terminal region; anti-AIPL1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: DLDELQKEPQPLVFVIELLQVDAPSDYQRETWNLSNHEKMKAVPVLHGEG
Sequence Length
270
Applicable Applications for anti-AIPL1 antibody
WB (Western Blot)
Predicted Species Reactivity
Human, Mouse, Rat, Cow, Horse, Pig, Rabbit
Homology
Cow: 79%; Horse: 86%; Human: 100%; Mouse: 77%; Pig: 86%; Rabbit: 79%; Rat: 77%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human AIPL1
Protein Size
270 amino acids
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Host: RabbitTarget Name: AIPL1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA201483_WB15.jpg WB (Western Blot) (Host: RabbitTarget Name: AIPL1Sample Tissue: Human HepG2 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-AIPL1 antibody
Target Description: Leber congenital amaurosis (LCA) is the most severe inherited retinopathy with the earliest age of onset and accounts for at least 5% of all inherited retinal diseases. Affected individuals are identified at birth or in the first few months of life with nystagmus, severely impaired vision or blindness and an abnormal or flat electroretinogram. The photoreceptor/pineal-expressed gene, AIPL1, encoding aryl-hydrocarbon interacting protein-like 1, is located within the LCA4 candidate region. The encoded protein contains three tetratricopeptide motifs, consistent with chaperone or nuclear transport activity. Mutations in this gene may cause approximately 20% of recessive LCA. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-AIPL1 antibody

NCBI and Uniprot Product Information

NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
Protein
NCBI Official Synonym Full Names
aryl hydrocarbon receptor interacting protein like 1
NCBI Official Symbol
AIPL1
NCBI Official Synonym Symbols
LCA4; AIPL2
NCBI Protein Information
aryl-hydrocarbon-interacting protein-like 1

Similar Products

Product Notes

The AIPL1 (Catalog #AAA201483) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AIPL1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's AIPL1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the AIPL1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLDELQKEPQ PLVFVIELLQ VDAPSDYQRE TWNLSNHEKM KAVPVLHGEG. It is sometimes possible for the material contained within the vial of "AIPL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.