WB (Western Blot)
(WB Suggested Anti-AK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: RPMI 8226 cell lysateAK2 is strongly supported by BioGPS gene expression data to be expressed in RPMI-8226)
Rabbit AK2 Polyclonal Antibody | anti-AK2 antibody
AK2 antibody - middle region
Gene Names
AK2; ADK2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
AK2, Antibody; AK2 antibody - middle region; anti-AK2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHT
Sequence Length
239
Applicable Applications for anti-AK2 antibody
WB (Western Blot)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 92%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human AK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-AK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: RPMI 8226 cell lysateAK2 is strongly supported by BioGPS gene expression data to be expressed in RPMI-8226)
WB (Western Blot)
(WB Suggested Anti-AK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: RPMI 8226 cell lysateAK2 is strongly supported by BioGPS gene expression data to be expressed in RPMI-8226)
WB (Western Blot)
(Host: MouseTarget Name: AK2Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
WB (Western Blot)
(Host: MouseTarget Name: AK2Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Related Product Information for anti-AK2 antibody
This is a rabbit polyclonal antibody against AK2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis.
Target Description: Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis.
Product Categories/Family for anti-AK2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
adenylate kinase 2, mitochondrial isoform a
NCBI Official Synonym Full Names
adenylate kinase 2
NCBI Official Symbol
AK2
NCBI Official Synonym Symbols
ADK2
NCBI Protein Information
adenylate kinase 2, mitochondrial
UniProt Protein Name
Adenylate kinase 2, mitochondrial
UniProt Gene Name
AK2
UniProt Entry Name
KAD2_HUMAN
Similar Products
Product Notes
The AK2 ak2 (Catalog #AAA199648) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The AK2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's AK2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the AK2 ak2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LIHPKSGRSY HEEFNPPKEP MKDDITGEPL IRRSDDNEKA LKIRLQAYHT. It is sometimes possible for the material contained within the vial of "AK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.