Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198086_WB13.jpg WB (Western Blot) (WB Suggested Anti-ANXA1 Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit ANXA1 Polyclonal Antibody | anti-ANXA1 antibody

ANXA1 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
ANXA1; ANX1; LPC1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ANXA1, Antibody; ANXA1 antibody - N-terminal region; anti-ANXA1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TFNPSSDVAALHKAIMVKGVDEATIIDILTKRNNAQRQQIKAAYLQETGK
Sequence Length
346
Applicable Applications for anti-ANXA1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ANXA1 Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA198086_WB13.jpg WB (Western Blot) (WB Suggested Anti-ANXA1 Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysate)

IHC (Immunohistochemistry)

(Immunohistochemistry with Placenta tissue at an antibody concentration of 5ug/ml using anti-ANXA1 antibody)

product-image-AAA198086_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with Placenta tissue at an antibody concentration of 5ug/ml using anti-ANXA1 antibody)
Related Product Information for anti-ANXA1 antibody
This is a rabbit polyclonal antibody against ANXA1. It was validated on Western Blot

Target Description: Annexin I belongs to a family of Ca(2+)-dependent phospholipid binding proteins which have a molecular weight of approximately 35,000 to 40,000 and are preferentially located on the cytosolic face of the plasma membrane. Annexin I protein has an apparent relative molecular mass of 40 kDa, with phospholipase A2 inhibitory activity. Since phospholipase A2 is required for the biosynthesis of the potent mediators of inflammation, prostaglandins and leukotrienes, annexin I may have potential anti-inflammatory activity.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
301
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
annexin A1
NCBI Official Synonym Full Names
annexin A1
NCBI Official Symbol
ANXA1
NCBI Official Synonym Symbols
ANX1; LPC1
NCBI Protein Information
annexin A1
UniProt Protein Name
Annexin A1
UniProt Gene Name
ANXA1
UniProt Synonym Gene Names
ANX1; LPC1
UniProt Entry Name
ANXA1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ANXA1 anxa1 (Catalog #AAA198086) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ANXA1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ANXA1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ANXA1 anxa1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TFNPSSDVAA LHKAIMVKGV DEATIIDILT KRNNAQRQQI KAAYLQETGK. It is sometimes possible for the material contained within the vial of "ANXA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.