WB (Western Blot)
(Sample Type: Human 721_BAPOE antibody - N-terminal region validated by WB using 721_B cell lysate at 1.0ug/ml.There is BioGPS gene expression data showing that APOE is expressed in 721_B)
Rabbit APOE Polyclonal Antibody | anti-APOE antibody
APOE antibody - N-terminal region
Gene Names
APOE; AD2; LPG; APO-E; ApoE4; LDLCQ5
Reactivity
Human, Mouse, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
APOE, Antibody; APOE antibody - N-terminal region; anti-APOE antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVC
Sequence Length
317
Applicable Applications for anti-APOE antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Human: 100%; Mouse: 93%; Rat: 93%; Zebrafish: 77%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(Sample Type: Human 721_BAPOE antibody - N-terminal region validated by WB using 721_B cell lysate at 1.0ug/ml.There is BioGPS gene expression data showing that APOE is expressed in 721_B)
WB (Western Blot)
(Sample Type: Human 721_BAPOE antibody - N-terminal region validated by WB using 721_B cell lysate at 1.0ug/ml.There is BioGPS gene expression data showing that APOE is expressed in 721_B)
WB (Western Blot)
(Sample Type: Mouse BrainSample Type:2. mouse brain extracts (80ug)3. rat brain extract(80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)
WB (Western Blot)
(Sample Type: Mouse BrainSample Type:2. mouse brain extracts (80ug)3. rat brain extract(80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)
IHC (Immunohistochemistry)
(Researcher: Dr. Yuzhi Chen, University of Arkansas for Medical ScienceApplication: IHCSpecies+tissue/cell type: Mouse brain stem cellsPrimary antibody dilution: 1:500Secondary antibody: Goat anti-rabbit Alexa-Fluor 594Secondary antibody dilution: 1:1000)
IHC (Immunohistochemistry)
(Researcher: Dr. Yuzhi Chen, University of Arkansas for Medical ScienceApplication: IHCSpecies+tissue/cell type: Mouse brain stem cellsPrimary antibody dilution: 1:500Secondary antibody: Goat anti-rabbit Alexa-Fluor 594Secondary antibody dilution: 1:1000)
Related Product Information for anti-APOE antibody
This is a rabbit polyclonal antibody against APOE. It was validated on Western Blot
Target Description: Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.
Target Description: Chylomicron remnants and very low density lipoprotein (VLDL) remnants are rapidly removed from the circulation by receptor-mediated endocytosis in the liver. Apolipoprotein E, a main apoprotein of the chylomicron, binds to a specific receptor on liver cells and peripheral cells. ApoE is essential for the normal catabolism of triglyceride-rich lipoprotein constituents. The APOE gene is mapped to chromosome 19 in a cluster with APOC1 and APOC2. Defects in apolipoprotein E result in familial dysbetalipoproteinemia, or type III hyperlipoproteinemia (HLP III), in which increased plasma cholesterol and triglycerides are the consequence of impaired clearance of chylomicron and VLDL remnants.
Product Categories/Family for anti-APOE antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
apolipoprotein E isoform b
NCBI Official Synonym Full Names
apolipoprotein E
NCBI Official Symbol
APOE
NCBI Official Synonym Symbols
AD2; LPG; APO-E; ApoE4; LDLCQ5
NCBI Protein Information
apolipoprotein E
UniProt Protein Name
Apolipoprotein E
UniProt Gene Name
APOE
UniProt Synonym Gene Names
Apo-E
UniProt Entry Name
APOE_HUMAN
Similar Products
Product Notes
The APOE apoe (Catalog #AAA200344) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The APOE antibody - N-terminal region reacts with Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's APOE can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the APOE apoe for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LMDETMKELK AYKSELEEQL TPVAEETRAR LSKELQAAQA RLGADMEDVC. It is sometimes possible for the material contained within the vial of "APOE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.