Goat ARD1 Polyclonal Antibody | anti-ARD1 antibody
ARD1 Polyclonal Antibody
Reactivity
Peptides from Archeoprepona genus
Applications
Western Blot
Purity
Epitope affinity purified
Synonyms
ARD1, Antibody; ARD1 Polyclonal Antibody; Anti-ARD1; Heliomycin; ETD135; ETD151 antibody; anti-ARD1 antibody
Host
Goat
Reactivity
Peptides from Archeoprepona genus
Clonality
Polyclonal
Isotype
IgG
Specificity
Using the recombinant ARD1 gives a positive signal by Western blot. Due to high homology it is likely to recognise heliomycin.
Purity/Purification
Epitope affinity purified
Form/Format
Polyclonal antibody supplied as a 100ul (2mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Sequence Length
226
Applicable Applications for anti-ARD1 antibody
WB (Western Blot)
Immunogen
Purified recombinant defensin ARD1 from one-spotted prepona (MDKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET) produced in E. coli.
Conjugation
Unconjugated
Antigen
Purified recombinant defensin ARD1 (MDKLIGSCVWGAVNYTSNCRAECKRRGYKGGHCGSFANVNCWCET) produced in E. coli
Handling
The antibody solution should be gently mixed before use.
Preparation and Storage
Store at -20 degree C for long-term storage. Store at 2-8 degree C for up to one month.
For continuous use, store at 2-8 degree C for one-two days. For extended storage, store in -20 degree C freezer. Working dilution samples should be discarded if not used within 12 hours.
Avoid freeze/thaw cycles.
For continuous use, store at 2-8 degree C for one-two days. For extended storage, store in -20 degree C freezer. Working dilution samples should be discarded if not used within 12 hours.
Avoid freeze/thaw cycles.
Related Product Information for anti-ARD1 antibody
Chain A defensin ARD1
Goat polyclonal antibody to Chain A defensin ARD1. This peptide isolated from one-spotted leafwing butterfly and moth has been shown to have antimicrobial properties.
Goat polyclonal antibody to Chain A defensin ARD1. This peptide isolated from one-spotted leafwing butterfly and moth has been shown to have antimicrobial properties.
NCBI and Uniprot Product Information
NCBI GI #
NCBI Official Full Name
ARD1
Similar Products
Product Notes
The ARD1 (Catalog #AAA63150) is an Antibody produced from Goat and is intended for research purposes only. The product is available for immediate purchase. The ARD1 Polyclonal Antibody reacts with Peptides from Archeoprepona genus and may cross-react with other species as described in the data sheet. AAA Biotech's ARD1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ARD1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ARD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
