Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199884_WB8.jpg WB (Western Blot) (Sample Type: 1. Human NT-2 cells (60ug)2. mouse brain extracts (80ug)Primary antibody dilution: 2ug/mlSecondary antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary antibody dilution: 1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)

Rabbit ARF1 Polyclonal Antibody | anti-ARF1 antibody

ARF1 antibody - middle region

Gene Names
ARF1; PVNH8
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish, Yeast
Applications
Western Blot, Immunoprecipitation, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ARF1, Antibody; ARF1 antibody - middle region; anti-ARF1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA
Sequence Length
181
Applicable Applications for anti-ARF1 antibody
WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Yeast 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Sample Type: 1. Human NT-2 cells (60ug)2. mouse brain extracts (80ug)Primary antibody dilution: 2ug/mlSecondary antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary antibody dilution: 1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)

product-image-AAA199884_WB8.jpg WB (Western Blot) (Sample Type: 1. Human NT-2 cells (60ug)2. mouse brain extracts (80ug)Primary antibody dilution: 2ug/mlSecondary antibody: IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary antibody dilution: 1: 20,000Image Submitted by: Yuzhi ChenUniversity of Arkansas for Medical Science)

WB (Western Blot)

(Sample Type: Human FetalLungARF1 antibody - middle region validated by WB using Fetal lung Lysate at 0.2-1 ug/ml.)

product-image-AAA199884_WB10.jpg WB (Western Blot) (Sample Type: Human FetalLungARF1 antibody - middle region validated by WB using Fetal lung Lysate at 0.2-1 ug/ml.)

IP (Immunoprecipitation)

(Sample Type :Mouse Brain lysate)

product-image-AAA199884_IP11.jpg IP (Immunoprecipitation) (Sample Type :Mouse Brain lysate)

IP (Immunoprecipitation)

(Sample Type: Rat brainAmount and Sample Type :500 ug rat brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :ARF1Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :ARF1Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

product-image-AAA199884_IP13.jpg IP (Immunoprecipitation) (Sample Type: Rat brainAmount and Sample Type :500 ug rat brain homogenateAmount of IP Antibody :6 ugPrimary Antibody :ARF1Primary Antibody Dilution :1:500Secondary Antibody :Goat anti-rabbit Alexa-Fluor 594Secondary Antibody Dilution :1:5000Gene Name :ARF1Submitted by :Dr. Yuzhi Chen, University of Arkansas for Medical Science)

IHC (Immunohistochemistry)

(Researcher: Dr. Yuzhi Chen, University of Arkansas for Medical ScienceApplication: IHCSpecies+tissue/cell type: Mouse brain stem cellsPrimary antibody dilution: 1:500Secondary antibody: Goat anti-rabbit Alexa-Fluor 594Secondary antibody dilution: 1:1000)

product-image-AAA199884_IHC15.jpg IHC (Immunohistochemistry) (Researcher: Dr. Yuzhi Chen, University of Arkansas for Medical ScienceApplication: IHCSpecies+tissue/cell type: Mouse brain stem cellsPrimary antibody dilution: 1:500Secondary antibody: Goat anti-rabbit Alexa-Fluor 594Secondary antibody dilution: 1:1000)
Related Product Information for anti-ARF1 antibody
This is a rabbit polyclonal antibody against ARF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ADP-ribosylation factor 1 (ARF1) is a member of the human ARF family. The family is composed of small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. These protein, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.ADP-ribosylation factor 1 (ARF1) is a member of the human ARF gene family. The family members encode small guanine nucleotide-binding proteins that stimulate the ADP-ribosyltransferase activity of cholera toxin and play a role in vesicular trafficking as activators of phospholipase D. The gene products, including 6 ARF proteins and 11 ARF-like proteins, constitute a family of the RAS superfamily. The ARF proteins are categorized as class I (ARF1, ARF2 and ARF3), class II (ARF4 and ARF5) and class III (ARF6), and members of each class share a common gene organization. The ARF1 protein is localized to the Golgi apparatus and has a central role in intra-Golgi transport. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
375
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
ADP-ribosylation factor 1
NCBI Official Synonym Full Names
ADP ribosylation factor 1
NCBI Official Symbol
ARF1
NCBI Official Synonym Symbols
PVNH8
NCBI Protein Information
ADP-ribosylation factor 1
UniProt Protein Name
ADP-ribosylation factor 3
UniProt Gene Name
ARF3
UniProt Entry Name
ARF3_HUMAN

Similar Products

Product Notes

The ARF1 arf3 (Catalog #AAA199884) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARF1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's ARF1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IP (Immunoprecipitation), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ARF1 arf3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MRMLAEDELR DAVLLVFANK QDLPNAMNAA EITDKLGLHS LRHRNWYIQA. It is sometimes possible for the material contained within the vial of "ARF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.