Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199846_WB11.jpg WB (Western Blot) (Sample Type: HepG2 cell lysateAntibody concentration: 1.0 ug/mlGel concentration: 12%.ARRB2 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit ARRB2 Polyclonal Antibody | anti-ARRB2 antibody

ARRB2 antibody - middle region

Average rating 0.0
No ratings yet
Gene Names
ARRB2; ARB2; ARR2; BARR2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ARRB2, Antibody; ARRB2 antibody - middle region; anti-ARRB2 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL
Sequence Length
409
Applicable Applications for anti-ARRB2 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ARRB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(Sample Type: HepG2 cell lysateAntibody concentration: 1.0 ug/mlGel concentration: 12%.ARRB2 is supported by BioGPS gene expression data to be expressed in HepG2)

product-image-AAA199846_WB11.jpg WB (Western Blot) (Sample Type: HepG2 cell lysateAntibody concentration: 1.0 ug/mlGel concentration: 12%.ARRB2 is supported by BioGPS gene expression data to be expressed in HepG2)

WB (Western Blot)

(Sample Type :Lane 1: 20ug mouse left ventricle heart lysate Primary Antibody Dilution :1:1000 Secondary Antibody:Anti-rabbit-HRP Secondary Antibody Dilution:1:5000 Color/Signal Descriptions:ARRB2 Gene Name:Kathleen Gabrielson Submitted by:)

product-image-AAA199846_WB13.jpg WB (Western Blot) (Sample Type :Lane 1: 20ug mouse left ventricle heart lysate Primary Antibody Dilution :1:1000 Secondary Antibody:Anti-rabbit-HRP Secondary Antibody Dilution:1:5000 Color/Signal Descriptions:ARRB2 Gene Name:Kathleen Gabrielson Submitted by:)

IHC (Immunohistochemistry)

(Human Skin)

product-image-AAA199846_IHC15.jpg IHC (Immunohistochemistry) (Human Skin)
Related Product Information for anti-ARRB2 antibody
This is a rabbit polyclonal antibody against ARRB2. It was validated on Western Blot and immunohistochemistry

Target Description: Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. ARRB2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors.Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
409
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
beta-arrestin-2 isoform 2
NCBI Official Synonym Full Names
arrestin beta 2
NCBI Official Symbol
ARRB2
NCBI Official Synonym Symbols
ARB2; ARR2; BARR2
NCBI Protein Information
beta-arrestin-2
UniProt Protein Name
Beta-arrestin-2
UniProt Gene Name
ARRB2
UniProt Synonym Gene Names
ARB2; ARR2
UniProt Entry Name
ARRB2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The ARRB2 arrb2 (Catalog #AAA199846) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ARRB2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ARRB2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ARRB2 arrb2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RLVIRKVQFA PEKPGPQPSA ETTRHFLMSD RSLHLEASLD KELYYHGEPL. It is sometimes possible for the material contained within the vial of "ARRB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.