Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46267_IHC11.jpg IHC (Immunohistochemisry) (Anti- SERCA1 ATPase antibody, IHC(P)IHC(P): Mouse Skeletal Muscle Tissue)

ATP2A1 Polyclonal Antibody | anti-ATP2A1 antibody

Anti-ATP2A1 Antibody

Gene Names
ATP2A1; ATP2A; SERCA1
Reactivity
Mouse, Rat
Predicted to work with: Human
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
ATP2A1, Antibody; Anti-ATP2A1 Antibody; Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 ; fast twitch skeletal muscle isoform; AT2A1_HUMAN; ATP2A; ATP2A1; ATPase Ca++ transporting cardiac muscle fast twitch 1; ATPase Ca++ transporting fast twitch 1; ATPase, Ca(2+)-transporting fast twitch 1; Calcium pump 1; Calcium transporting ATPase sarcoplasmic reticulum type fast twitch skeletal muscle isoform; Calcium-transporting ATPase sarcoplasmic reticulum type; Endoplasmic reticulum class 1/2 Ca(2+) ATPase; Fast skeletal muscle SR calcium ATPase; OTTHUMP00000162561; OTTHUMP00000162562; Sarcoendoplasmic reticulum calcium ATPase; Sarcoplasmic reticulum Ca(2+)-ATPase 1; Sarcoplasmic/endoplasmic reticulum calcium ATPase 1; SERCA 1; SERCA1; SERCA1 truncated isoform, included; SR Ca(2+) ATPase 1; SR Ca(2+)-ATPase 1; ATPase, Ca++ transporting, cardiac muscle, fast twitch 1; anti-ATP2A1 antibody
Ordering
Reactivity
Mouse, Rat
Predicted to work with: Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
869
Applicable Applications for anti-ATP2A1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ATP2A1 (1-32aa MEAAHAKTTEECLAYFGVSETTGLTPDQVKRN), different from the related mouse and rat sequences by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemisry)

(Anti- SERCA1 ATPase antibody, IHC(P)IHC(P): Mouse Skeletal Muscle Tissue)

product-image-AAA46267_IHC11.jpg IHC (Immunohistochemisry) (Anti- SERCA1 ATPase antibody, IHC(P)IHC(P): Mouse Skeletal Muscle Tissue)

IHC (Immunohiostchemistry)

(Anti- SERCA1 ATPase antibody,IHC(P)IHC(P): Rat Skeletal Muscle Tissue)

product-image-AAA46267_IHC13.jpg IHC (Immunohiostchemistry) (Anti- SERCA1 ATPase antibody,IHC(P)IHC(P): Rat Skeletal Muscle Tissue)

WB (Western Blot)

(Anti- SERCA1 ATPase antibody, Western blottingAll lanes: Anti SERCA1 ATPase at 0.5ug/mlLane 1: Rat Skeletal Muscle Tissue Lysate at 50ugLane 2: Mouse Skeletal Muscle Tissue Lysate at 50ugPredicted bind size: 110KDObserved bind size: 110KD)

product-image-AAA46267_WB15.jpg WB (Western Blot) (Anti- SERCA1 ATPase antibody, Western blottingAll lanes: Anti SERCA1 ATPase at 0.5ug/mlLane 1: Rat Skeletal Muscle Tissue Lysate at 50ugLane 2: Mouse Skeletal Muscle Tissue Lysate at 50ugPredicted bind size: 110KDObserved bind size: 110KD)
Related Product Information for anti-ATP2A1 antibody
Description: Rabbit IgG polyclonal antibody for Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 (ATP2A1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: SERCA1, also called ATP2A1, is an enzyme that in humans is encoded by the ATP2A1 gene. This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. The SERCA1 gene is mapped to 16p11.2. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. It has been determined that the human SERCA1 gene is 26 kb long and contains 23 exons, of which can be alternatively spliced. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise.
References
1. Brandl, C. J., Green, N. M., Korczak, B., MacLennan, D. H. Two Ca(2+) ATPase genes: homologies and mechanistic implications of deduced amino acid sequences. Cell 44: 597-607, 1986. 2. Karpati, G., Charuk, J., Carpenter, S., Jablecki, C., Holland, P. Myopathy caused by a deficiency of Ca(2+)-adenosine triphosphatase in sarcoplasmic reticulum (Brody's disease). Ann. Neurol. 20: 38-49, 1986. 3. Zhang, Y., Fujii, J., Phillips, M. S., Chen, H.-S., Karpati, G., Yee, W.-C., Schrank, B., Cornblath, D. R., Boyland, K. B., MacLennan, D. H. Characterization of cDNA and genomic DNA encoding SERCA1, the Ca(2+)-ATPase of human fast-twitch skeletal muscle sarcoplasmic reticulum, and its elimination as a candidate gene for Brody disease. Gemomics 30: 415-424, 1995.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
487
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95,199 Da
NCBI Official Full Name
sarcoplasmic/endoplasmic reticulum calcium ATPase 1 isoform c
NCBI Official Synonym Full Names
ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1
NCBI Official Symbol
ATP2A1
NCBI Official Synonym Symbols
ATP2A; SERCA1
NCBI Protein Information
sarcoplasmic/endoplasmic reticulum calcium ATPase 1
UniProt Protein Name
Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
UniProt Gene Name
ATP2A1
UniProt Synonym Gene Names
SERCA1; SR Ca(2+)-ATPase 1
UniProt Entry Name
AT2A1_HUMAN

Similar Products

Product Notes

The ATP2A1 atp2a1 (Catalog #AAA46267) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-ATP2A1 Antibody reacts with Mouse, Rat Predicted to work with: Human and may cross-react with other species as described in the data sheet. AAA Biotech's ATP2A1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the ATP2A1 atp2a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ATP2A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.