Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199063_WB13.jpg WB (Western Blot) (WB Suggested Anti-ATP2A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)

Rabbit ATP2A1 Polyclonal Antibody | anti-ATP2A1 antibody

ATP2A1 antibody - N-terminal region

Gene Names
ATP2A1; ATP2A; SERCA1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
ATP2A1, Antibody; ATP2A1 antibody - N-terminal region; anti-ATP2A1 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW
Sequence Length
994
Applicable Applications for anti-ATP2A1 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 92%; Guinea Pig: 100%; Horse: 85%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ATP2A1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-ATP2A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)

product-image-AAA199063_WB13.jpg WB (Western Blot) (WB Suggested Anti-ATP2A1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: THP-1 cell lysate)

IHC (Immunohistochemistry)

(Sample Type :Rhesus macaque spinal cordPrimary Antibody Dilution :1:300Secondary Antibody :Donkey anti Rabbit 488Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: ATP2A1Gene Name :ATP2A1Submitted by :Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706)

product-image-AAA199063_IHC15.jpg IHC (Immunohistochemistry) (Sample Type :Rhesus macaque spinal cordPrimary Antibody Dilution :1:300Secondary Antibody :Donkey anti Rabbit 488Secondary Antibody Dilution :1:500Color/Signal Descriptions :Green: ATP2A1Gene Name :ATP2A1Submitted by :Timur Mavlyutov, Ph. D., Department of Pharmacology, University of Wisconsin Medical School, 1300 University Avenue, Madison, WI 53706)
Related Product Information for anti-ATP2A1 antibody
This is a rabbit polyclonal antibody against ATP2A1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to
Product Categories/Family for anti-ATP2A1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
487
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
109kDa
NCBI Official Full Name
sarcoplasmic/endoplasmic reticulum calcium ATPase 1 isoform a
NCBI Official Synonym Full Names
ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1
NCBI Official Symbol
ATP2A1
NCBI Official Synonym Symbols
ATP2A; SERCA1
NCBI Protein Information
sarcoplasmic/endoplasmic reticulum calcium ATPase 1
UniProt Protein Name
Putative uncharacterized protein DKFZp779O2152
UniProt Gene Name
DKFZp779O2152
UniProt Entry Name
Q7Z675_HUMAN

Similar Products

Product Notes

The ATP2A1 dkfzp779o2152 (Catalog #AAA199063) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATP2A1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ATP2A1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the ATP2A1 dkfzp779o2152 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MEAAHAKTTE ECLAYFGVSE TTGLTPDQVK RNLEKYGLNE LPAEEGKTLW. It is sometimes possible for the material contained within the vial of "ATP2A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.