WB (Western Blot)
(Western blot analysis of Mouse brain, using ATRX Rabbit pAb (AAA282366) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 60s.)
Rabbit anti-Human, Mouse ATRX Polyclonal Antibody | anti-ATRX antibody
ATRX Rabbit pAb
Gene Names
ATRX; JMS; SHS; XH2; XNP; ATR2; SFM1; RAD54; MRXHF1; RAD54L; ZNF-HX
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purification
Synonyms
ATRX, Antibody; ATRX Rabbit pAb; JMS; XH2; XNP; MRX52; RAD54; RAD54L; ZNF-HX; anti-ATRX antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
EEFNDETNVRGRLFIISTKAGSLGINLVAANRVIIFDASWNPSYDIQSIFRVYRFGQTKPVYVYRFLAQGTMEDKIYDRQVTKQSLSFRVVDQQQVERHFT
Applicable Applications for anti-ATRX antibody
WB (Western Blot)
Positive Samples
HeLa, Mouse brain
Cellular Location
nuclear body, nuclear chromosome, nucleoplasm, nucleus, PML body
Research Area
Epigenetics Nuclear Signaling, Transcription Factors, Chromatin Remodeling
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 2100-2200 of human ATRX (NP_000480.3).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Ship: Ice Pack
Ship: Ice Pack
WB (Western Blot)
(Western blot analysis of Mouse brain, using ATRX Rabbit pAb (AAA282366) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 60s.)
WB (Western Blot)
(Western blot analysis of Mouse brain, using ATRX Rabbit pAb (AAA282366) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 60s.)
WB (Western Blot)
(Western blot analysis of various lysates, using ATRX Rabbit pAb (AAA282366) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 60s.)
WB (Western Blot)
(Western blot analysis of various lysates, using ATRX Rabbit pAb (AAA282366) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 60s.)
Related Product Information for anti-ATRX antibody
The protein encoded by this gene contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Mutations in this gene are associated with X-linked syndromes exhibiting cognitive disabilities as well as alpha-thalassemia (ATRX) syndrome. These mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. Multiple alternatively spliced transcript variants encoding distinct isoforms have been reported.
Product Categories/Family for anti-ATRX antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
282,586 Da
NCBI Official Full Name
transcriptional regulator ATRX isoform 1
NCBI Official Synonym Full Names
alpha thalassemia/mental retardation syndrome X-linked
NCBI Official Symbol
ATRX
NCBI Official Synonym Symbols
JMS; SHS; XH2; XNP; ATR2; SFM1; RAD54; MRXHF1; RAD54L; ZNF-HX
NCBI Protein Information
transcriptional regulator ATRX; RAD54 homolog; X-linked helicase II; Zinc finger helicase; helicase 2, X-linked; X-linked nuclear protein; ATP-dependent helicase ATRX; DNA dependent ATPase and helicase; alpha thalassemia/mental retardation syndrome X-link
UniProt Protein Name
Transcriptional regulator ATRX
UniProt Gene Name
ATRX
UniProt Synonym Gene Names
RAD54L; XH2; XNP
UniProt Entry Name
ATRX_HUMAN
Similar Products
Product Notes
The ATRX atrx (Catalog #AAA282366) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ATRX Rabbit pAb reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ATRX can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the ATRX atrx for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EEFNDETNVR GRLFIISTKA GSLGINLVAA NRVIIFDASW NPSYDIQSIF RVYRFGQTKP VYVYRFLAQG TMEDKIYDRQ VTKQSLSFRV VDQQQVERHF T. It is sometimes possible for the material contained within the vial of "ATRX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.