Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46712_IHC8.jpg IHC (Immunohistochemistry) (Bax was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- Bax Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit Bax Polyclonal Antibody | anti-BAX antibody

Anti-Bax Antibody

Average rating 0.0
No ratings yet
Gene Names
BAX; BCL2L4
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
Bax, Antibody; Anti-Bax Antibody; Apoptosis regulator BAX; BAXA; Bcl2-L-4; BCL2L4; Bcl-2-like protein 4; Q07812; BCL2-associated X protein; anti-BAX antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
221
Applicable Applications for anti-BAX antibody
IHC (Immunohistochemistry), WB (Western Blot)
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human Bax (17-48aa EQIMKTGALLLQGFIQDRAGRMGGEAPELALD), different from the related mouse and rat sequences by five amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Bax was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- Bax Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46712_IHC8.jpg IHC (Immunohistochemistry) (Bax was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- Bax Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemistry)

(Bax was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- Bax Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46712_IHC10.jpg IHC (Immunohistochemistry) (Bax was detected in paraffin-embedded sections of human intetsinal cancer tissues using rabbit anti- Bax Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemisry)

(Bax was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- Bax Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46712_IHC11.jpg IHC (Immunohistochemisry) (Bax was detected in paraffin-embedded sections of rat intestine tissues using rabbit anti- Bax Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(Bax was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- Bax Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46712_IHC13.jpg IHC (Immunohiostchemistry) (Bax was detected in paraffin-embedded sections of mouse intestine tissues using rabbit anti- Bax Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of Bax expression in rat thymus extract (lane 1), mouse thymus extract (lane 2), HEPA1-6 whole cell lysates (lane 3), HELA whole cell lysates (lane 4) and MCF-7 whole cell lysates (lane 5). Bax at 21KD was detected using rabbit anti- Bax Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46712_WB15.jpg WB (Western Blot) (Western blot analysis of Bax expression in rat thymus extract (lane 1), mouse thymus extract (lane 2), HEPA1-6 whole cell lysates (lane 3), HELA whole cell lysates (lane 4) and MCF-7 whole cell lysates (lane 5). Bax at 21KD was detected using rabbit anti- Bax Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-BAX antibody
Rabbit IgG polyclonal antibody for Apoptosis regulator BAX(BAX) detection.
Background: Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.
References
1. Apte, S. S.; Mattei, M.-G.; Olsen, B. R. : Mapping of human BAX gene to chromosome 19q13.3-q13.4 and isolation of a novel alternatively spliced transcript, BAX-delta. Genomics 26: 592-594, 1995.
2. Guo, B.; Zhai, D.; Cabezas, E.; Welsh, K.; Nouraini, S.; Satterthwait, A. C.; Reed, J. C. : Humanin peptide suppresses apoptosis by interfering with Bax activation. Nature 423: 456-461, 2003.
3. Oltvai, Z. N.; Milliman, C. L.; Korsmeyer, S. J. : Bcl-2 heterodimers in vivo with a conserved homolog, Bax, that accelerates programmed cell death. Cell 74: 609-619, 1993.
4. Takeuchi, O.; Fisher, J.; Suh, H.; Harada, H.; Malynn, B. A.; Korsmeyer, S. J. : Essential role of BAX, BAK in B cell homeostasis and prevention of autoimmune disease. Proc. Nat. Acad. Sci. 102: 11272-11277, 2005.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
581
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19,718 Da
NCBI Official Full Name
apoptosis regulator BAX isoform 1
NCBI Official Synonym Full Names
BCL2 associated X, apoptosis regulator
NCBI Official Symbol
BAX
NCBI Official Synonym Symbols
BCL2L4
NCBI Protein Information
apoptosis regulator BAX
UniProt Protein Name
Apoptosis regulator BAX
UniProt Gene Name
BAX
UniProt Synonym Gene Names
BCL2L4; Bcl2-L-4

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The BAX bax (Catalog #AAA46712) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Bax Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Bax can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the BAX bax for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Bax, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.