Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201660_WB8.jpg WB (Western Blot) (WB Suggested Anti-BAX Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

Rabbit BAX Polyclonal Antibody | anti-BAX antibody

BAX antibody - N-terminal region

Gene Names
BAX; BCL2L4
Reactivity
Cow, Dog, Human, Pig
Applications
Western Blot, Immunohistochemistry
Purity
Protein A purified
Synonyms
BAX, Antibody; BAX antibody - N-terminal region; anti-BAX antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Human, Pig
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPV
Sequence Length
192
Applicable Applications for anti-BAX antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 100%; Dog: 100%; Human: 100%; Pig: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human BAX
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-BAX Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA201660_WB8.jpg WB (Western Blot) (WB Suggested Anti-BAX Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysate)

WB (Western Blot)

(Lanes:1. Human NT-2 cells (60ug) lysate 2. Mouse WT brain extract (80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody:IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Gene Name:BAXSubmitted by:Dr. Yuzhi Chen, University of Arkansas for Medical Science)

product-image-AAA201660_WB10.jpg WB (Western Blot) (Lanes:1. Human NT-2 cells (60ug) lysate 2. Mouse WT brain extract (80ug)Primary Antibody Dilution:2ug/mlSecondary Antibody:IRDye 800CW goat anti-rabbit from Li-COR BioscienceSecondary Antibody Dilution:1: 20,000Gene Name:BAXSubmitted by:Dr. Yuzhi Chen, University of Arkansas for Medical Science)

IHC (Immunohistochemisry)

(Rabbit Anti-BAX AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA201660_IHC11.jpg IHC (Immunohistochemisry) (Rabbit Anti-BAX AntibodyParaffin Embedded Tissue: Human cardiac cellCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohiostchemistry)

(Immunohistochemistry with NT2, mouse brain; rat brain. tissue)

product-image-AAA201660_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry with NT2, mouse brain; rat brain. tissue)

IHC (Immunohistochemistry)

(Human kidney)

product-image-AAA201660_IHC15.jpg IHC (Immunohistochemistry) (Human kidney)
Related Product Information for anti-BAX antibody
This is a rabbit polyclonal antibody against BAX. It was validated on Western Blot and immunohistochemistry

Target Description: BAX encodes a protein that belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. BAX expression is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
581
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
apoptosis regulator BAX isoform alpha
NCBI Official Synonym Full Names
BCL2 associated X, apoptosis regulator
NCBI Official Symbol
BAX
NCBI Official Synonym Symbols
BCL2L4
NCBI Protein Information
apoptosis regulator BAX
UniProt Protein Name
Apoptosis regulator BAX
UniProt Gene Name
BAX
UniProt Synonym Gene Names
BCL2L4; Bcl2-L-4
UniProt Entry Name
BAX_HUMAN

Similar Products

Product Notes

The BAX bax (Catalog #AAA201660) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BAX antibody - N-terminal region reacts with Cow, Dog, Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's BAX can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the BAX bax for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDGSGEQPRG GGPTSSEQIM KTGALLLQGF IQDRAGRMGG EAPELALDPV. It is sometimes possible for the material contained within the vial of "BAX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.