Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46518_IHC10.jpg IHC (Immunohistochemistry) (BCAR3 was detected in paraffin-embedded sections of human tonsil tissues using rabbit anti- BCAR3 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

BCAR3 Polyclonal Antibody | anti-BCAR3 antibody

Anti-BCAR3 Antibody

Average rating 0.0
No ratings yet
Gene Names
BCAR3; NSP2; SH2D3B
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
BCAR3, Antibody; Anti-BCAR3 Antibody; Breast cancer anti-estrogen resistance protein 3; BCAR 3; BCAR3; BCAR3_HUMAN; Breast cancer anti estrogen resistance 3; Breast cancer anti estrogen resistance protein 3; Breast cancer antiestrogen resistance 3; dJ1033H22.2; dJ1033H22.2 breast cancer anti estrogen resistance 3; dJ1033H22.2 breast cancer antiestrogen resistance 3; KIAA0554; Novel SH2 containing protein 2; Novel SH2-containing protein 2; NSP 2; NSP2; SH2 containing protein Nsp2; SH2 domain containing protein 3B; SH2 domain-containing protein 3B; SH2D3B; breast cancer anti-estrogen resistance 3; anti-BCAR3 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
825
Applicable Applications for anti-BCAR3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human BCAR3 (791-825aa KGAQVNQTERYEKFNQILTALSRKLEPPPVKQAEL), different from the related mouse sequence by five amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(BCAR3 was detected in paraffin-embedded sections of human tonsil tissues using rabbit anti- BCAR3 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46518_IHC10.jpg IHC (Immunohistochemistry) (BCAR3 was detected in paraffin-embedded sections of human tonsil tissues using rabbit anti- BCAR3 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemisry)

(BCAR3 was detected in paraffin-embedded sections of rat spleen tissues using rabbit anti- BCAR3 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46518_IHC11.jpg IHC (Immunohistochemisry) (BCAR3 was detected in paraffin-embedded sections of rat spleen tissues using rabbit anti- BCAR3 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(BCAR3 was detected in paraffin-embedded sections of mouse lymphaden tissues using rabbit anti- BCAR3 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46518_IHC13.jpg IHC (Immunohiostchemistry) (BCAR3 was detected in paraffin-embedded sections of mouse lymphaden tissues using rabbit anti- BCAR3 Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of BCAR3 expression in HEPG2 whole cell lysates (lane 1). BCAR3 at 93KD was detected using rabbit anti- BCAR3 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46518_WB15.jpg WB (Western Blot) (Western blot analysis of BCAR3 expression in HEPG2 whole cell lysates (lane 1). BCAR3 at 93KD was detected using rabbit anti- BCAR3 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-BCAR3 antibody
Description: Rabbit IgG polyclonal antibody for Breast cancer anti-estrogen resistance protein 3(BCAR3) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Breast cancer anti-estrogen resistance protein 3 is a protein that in humans is encoded by the BCAR3 gene. Breast tumors are initially dependent on estrogens for growth and progression and can be inhibited by anti-estrogens such as tamoxifen. However, breast cancers progress to become anti-estrogen resistant. Breast cancer anti-estrogen resistance gene 3 was identified in the search for genes involved in the development of estrogen resistance. The gene encodes a component of intracellular signal transduction that causes estrogen-independent proliferation in human breast cancer cells. The protein contains a putative src homology 2 (SH2) domain, a hall mark of cellular tyrosine kinase signaling molecules, and is partly homologous to the cell division cycle protein CDC48. Multiple transcript variants encoding different isoforms have been found for this gene.
References
1. "Entrez Gene: BCAR3 breast cancer anti-estrogen resistance 3". 2. Dorssers LC, van Agthoven T, Brinkman A; et al. (2006). "Breast cancer oestrogen independence mediated by BCAR1 or BCAR3 genes is transmitted through mechanisms distinct from the oestrogen receptor signalling pathway or the epidermal growth factor receptor signalling pathway.". Breast Cancer Res. 7 (1): R82-92. 3. van Agthoven T, van Agthoven TL, Dekker A, van der Spek PJ, Vreede L, Dorssers LC (Jul 1998)."Identification of BCAR3 by a random search for genes involved in antiestrogen resistance of human breast cancer cells". EMBO J 17 (10): 2799-808.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82,357 Da
NCBI Official Full Name
breast cancer anti-estrogen resistance protein 3 isoform 1
NCBI Official Synonym Full Names
breast cancer anti-estrogen resistance 3
NCBI Official Symbol
BCAR3
NCBI Official Synonym Symbols
NSP2; SH2D3B
NCBI Protein Information
breast cancer anti-estrogen resistance protein 3
UniProt Protein Name
Breast cancer anti-estrogen resistance protein 3
UniProt Gene Name
BCAR3
UniProt Synonym Gene Names
NSP2; SH2D3B
UniProt Entry Name
BCAR3_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The BCAR3 bcar3 (Catalog #AAA46518) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-BCAR3 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BCAR3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the BCAR3 bcar3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BCAR3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.