Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA225838_WB13.jpg WB (Western Blot) (BCHE antibody used at 1.25 ug/ml to detect target protein.)

Rabbit BCHE Polyclonal Antibody | anti-BCHE antibody

BCHE Antibody

Average rating 0.0
No ratings yet
Reactivity
Human, Mouse, Dog
Applications
Immunohistochemistry, Western Blot
Purity
Total IgG Protein A purified
Synonyms
BCHE, Antibody; BCHE Antibody; Rabbit Polyclonal BCHE Antibody raised against the N terminal of BCHE; Polyclonal BCHE antibody; Anti-BCHE antibody; Butyrylcholinesterase antibody; E1 antibody; CHE1 antibody; anti-BCHE antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Dog
Clonality
Polyclonal
Specificity
BCHE antibody was raised against the N terminal of BCHE
Purity/Purification
Total IgG Protein A purified
Form/Format
Liquid; in 1x PBS buffer with 0.09% (w/v) Sodium Azide and 2% Sucrose.
Concentration
1 mg/ml (varies by lot)
Sequence Length
551
Applicable Applications for anti-BCHE antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
BCHE antibody was raised using the N terminal of BCHE corresponding to a region with amino acids SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ
Cross-Reactivity
Human,Mouse,Dog
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

WB (Western Blot)

(BCHE antibody used at 1.25 ug/ml to detect target protein.)

product-image-AAA225838_WB13.jpg WB (Western Blot) (BCHE antibody used at 1.25 ug/ml to detect target protein.)

IHC (Immunohistochemistry)

(BCHE antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X)

product-image-AAA225838_IHC15.jpg IHC (Immunohistochemistry) (BCHE antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Alveolar cells (arrows) in Human Lung. Magnification is at 400X)
Related Product Information for anti-BCHE antibody
Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage.
Product Categories/Family for anti-BCHE antibody

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
68 kDa (MW of target protein)
NCBI Official Full Name
BchE

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The BCHE (Catalog #AAA225838) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BCHE Antibody reacts with Human, Mouse, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's BCHE can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the BCHE for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "BCHE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.