Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28424_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using Bcl-2 Mouse mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

Mouse Bcl-2 Polyclonal Antibody | anti-Bcl-2 antibody

Bcl-2 Mouse mAb

Gene Names
VEGFA; VPF; VEGF; MVCD1
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunofluorescence, Immunocytochemistry
Purity
Affinity purification
Synonyms
Bcl-2, Antibody; Bcl-2 Mouse mAb; Bcl-2; PPP1R50; BCL2; anti-Bcl-2 antibody
Ordering
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
EYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERR
Applicable Applications for anti-Bcl-2 antibody
WB (Western Blot), IF (Immunofluorescence), ICC (Immunocytochemistry)
Application Notes
WB: 1:500-1:2000
IF/ICC: 1:50-1:200
Customer Validation: IF (Homo sapiens)
Positive Samples
Raji, Jurkat, 293T, NIH/3T3
Immunogen
Recombinant protein of mouse Bcl-2.
Cellular Location
Endoplasmic reticulum membrane, Mitochondrion outer membrane, Nucleus membrane, Single-pass membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of PC-12 cells using Bcl-2 Mouse mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28424_IF8.jpg IF (Immunofluorescence) (Immunofluorescence analysis of PC-12 cells using Bcl-2 Mouse mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of NIH/3T3 cells using Bcl-2 Mouse mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28424_IF7.jpg IF (Immunofluorescence) (Immunofluorescence analysis of NIH/3T3 cells using Bcl-2 Mouse mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using Bcl-2 Mouse mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA28424_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using Bcl-2 Mouse mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat lung using Bcl-2 Mouse mAb at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA28424_IHC5.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat lung using Bcl-2 Mouse mAb at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded mouse kidney using Bcl-2 Mouse mAb at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA28424_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded mouse kidney using Bcl-2 Mouse mAb at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human tonsil using Bcl-2 Mouse mAb at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA28424_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human tonsil using Bcl-2 Mouse mAb at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded human thyroid cancer using Bcl-2 Mouse mAb at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA28424_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded human thyroid cancer using Bcl-2 Mouse mAb at dilution of 1:500 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using Bcl-2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)

product-image-AAA28424_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using Bcl-2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Mouse IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.)
Related Product Information for anti-Bcl-2 antibody
This gene encodes an integral outer mitochondrial membrane protein that blocks the apoptotic death of some cells such as lymphocytes. Constitutive expression of BCL2, such as in the case of translocation of BCL2 to Ig heavy chain locus, is thought to be the cause of follicular lymphoma. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,042 Da
NCBI Official Full Name
vascular endothelial growth factor A isoform q
NCBI Official Synonym Full Names
vascular endothelial growth factor A
NCBI Official Symbol
VEGFA
NCBI Official Synonym Symbols
VPF; VEGF; MVCD1
NCBI Protein Information
vascular endothelial growth factor A; vascular permeability factor
UniProt Protein Name
Vascular endothelial growth factor A
UniProt Gene Name
VEGFA
UniProt Synonym Gene Names
VEGF; VEGF-A; VPF
UniProt Entry Name
VEGFA_HUMAN

Similar Products

Product Notes

The Bcl-2 vegfa (Catalog #AAA28424) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Bcl-2 Mouse mAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Bcl-2 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence), ICC (Immunocytochemistry). WB: 1:500-1:2000 IF/ICC: 1:50-1:200 Customer Validation: IF (Homo sapiens). Researchers should empirically determine the suitability of the Bcl-2 vegfa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EYIFKPSCVP LMRCGGCCND EGLECVPTEE SNITMQIMRI KPHQGQHIGE MSFLQHNKCE CRPKKDRARQ ENPCGPCSER R. It is sometimes possible for the material contained within the vial of "Bcl-2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.