Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46596_FCM11.jpg FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of A549 cells using anti-Bcl-X antibody (AAA46596).Overlay histogram showing A549 cells stained with AAA46596 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Bcl-X Antibody (AAA46596,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

Rabbit Bcl-X Polyclonal Antibody | anti-BCL2L1 antibody

Anti-Bcl-X Antibody

Average rating 0.0
No ratings yet
Gene Names
BCL2L1; BCLX; BCL2L; Bcl-X; PPP1R52; BCL-XL/S
Reactivity
Human
No cross reactivity with other proteins.
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
Bcl-X, Antibody; Anti-Bcl-X Antibody; Apoptosis regulator BclX; Bcl 2 like 1; Bcl2 like1; Bcl 2 like 1 protein; Bcl xL; BCL XL/S; Bcl xS; BCL2L; BCL2L1; Bclx; Q07817 ; Bcl-2-like protein 1; BCL2-like 1; anti-BCL2L1 antibody
Ordering
Host
Rabbit
Reactivity
Human
No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
170
Applicable Applications for anti-BCL2L1 antibody
WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Bcl-X (75-105aa LDAREVIPMAAVKQALREAGDEFELRYRRAF), identical to the related mouse and rat sequences.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

FCM/FACS (Flow Cytometry)

(Figure 3. Flow Cytometry analysis of A549 cells using anti-Bcl-X antibody (AAA46596).Overlay histogram showing A549 cells stained with AAA46596 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Bcl-X Antibody (AAA46596,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA46596_FCM11.jpg FCM/FACS (Flow Cytometry) (Figure 3. Flow Cytometry analysis of A549 cells using anti-Bcl-X antibody (AAA46596).Overlay histogram showing A549 cells stained with AAA46596 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Bcl-X Antibody (AAA46596,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

FCM/FACS (Flow Cytometry)

(Figure 2. Flow Cytometry analysis of PC-3 cells using anti-Bcl-X antibody (AAA46596).Overlay histogram showing PC-3 cells stained with AAA46596 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Bcl-X Antibody (AAA46596,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

product-image-AAA46596_FCM13.jpg FCM/FACS (Flow Cytometry) (Figure 2. Flow Cytometry analysis of PC-3 cells using anti-Bcl-X antibody (AAA46596).Overlay histogram showing PC-3 cells stained with AAA46596 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-Bcl-X Antibody (AAA46596,1ug/1x10^6 cells) for 30 min at 20 degree C. DyLight®488 conjugated goat anti-rabbit IgG (5-10ug/1x10^6 cells) was used as secondary antibody for 30 minutes at 20 degree C. Isotype control antibody (Green line) was rabbit IgG (1ug/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.)

WB (Western Blot)

(Figure 1. Western blot analysis of Bcl-X using anti- Bcl-X antibody (AAA46596).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: SW620 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- Bcl-X antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Bcl-X at approximately 29 KD, 60KD. The expected band size for Bcl-X is at 26KD.)

product-image-AAA46596_WB15.jpg WB (Western Blot) (Figure 1. Western blot analysis of Bcl-X using anti- Bcl-X antibody (AAA46596).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.Lane 1: SW620 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti- Bcl-X antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Bcl-X at approximately 29 KD, 60KD. The expected band size for Bcl-X is at 26KD.)
Related Product Information for anti-BCL2L1 antibody
Rabbit IgG polyclonal antibody for Bcl-2-like protein 1 (BCL2L1) detection.
Background: Bcl-2-like protein 1, also known as Bcl-X, is a protein that in humans is encoded by the BCL2L1 gene. The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Alternative splicing results in multiple transcript variants encoding two different isoforms. The longer isoform (Bcl-xL) acts as an apoptotic inhibitor and the shorter form (Bcl-xS) acts as an apoptotic activator.
References
1. "Entrez Gene: BCL2L1 BCL2-like 1".
2. Boise LH, González-García M, Postema CE, Ding L, Lindsten T, Turka LA, Mao X, Nuñez G, Thompson CB (Aug 1993). "bcl-x, a bcl-2-related gene that functions as a dominant regulator of apoptotic cell death". Cell 74(4): 597-608.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
598
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,290 Da
NCBI Official Full Name
bcl-2-like protein 1 isoform Bcl-X(S)
NCBI Official Synonym Full Names
BCL2 like 1
NCBI Official Symbol
BCL2L1
NCBI Official Synonym Symbols
BCLX; BCL2L; Bcl-X; PPP1R52; BCL-XL/S
NCBI Protein Information
bcl-2-like protein 1
UniProt Protein Name
Bcl-2-like protein 1
UniProt Gene Name
BCL2L1
UniProt Synonym Gene Names
BCL2L; BCLX; Bcl2-L-1
UniProt Entry Name
B2CL1_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The BCL2L1 bcl2l1 (Catalog #AAA46596) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Bcl-X Antibody reacts with Human No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's Bcl-X can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the BCL2L1 bcl2l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Bcl-X, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.