Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA28394_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using β-Tubulin antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

Rabbit beta-Tubulin Polyclonal Antibody | anti-TUBB antibody

beta-Tubulin Rabbit pAb

Gene Names
TUBB; M40; TUBB1; TUBB5; OK/SW-cl.56
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
beta-Tubulin, Antibody; beta-Tubulin Rabbit pAb; CDCBM6; CSCSC1; M40; OK/SW-cl.56; TUBB1; TUBB5; Beta Tubulin; TUBB; beta-Tubulin; anti-TUBB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
SDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPF
Applicable Applications for anti-TUBB antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IF: 1:50-1:200
Customer Validation:
WB: Mouse, Rat, Human, Bos taurus
IP: Human
WB: Human
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 40-260 of human beta-Tubulin (NP_006077.2).
Cellular Location
Cytoplasm, cytoskeleton
Positive Samples
SH-SY5Y, HeLa, A-549, MCF7, HepG2, Mouse eye, Rat spinal cord
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IF (Immunofluorescence)

(Immunofluorescence analysis of HeLa cells using β-Tubulin antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA28394_IF6.jpg IF (Immunofluorescence) (Immunofluorescence analysis of HeLa cells using β-Tubulin antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IF (Immunofluorescence)

(Immunofluorescence analysis of A431 cells using β-Tubulin antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

product-image-AAA28394_IF5.jpg IF (Immunofluorescence) (Immunofluorescence analysis of A431 cells using β-Tubulin antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded HepG2 cells treated by oleic acid using β-Tubulin antibody at dilution of 1:100 (40x lens).)

product-image-AAA28394_IHC4.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded HepG2 cells treated by oleic acid using β-Tubulin antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded HepG2 cells treated by oleic acid using β-Tubulin antibody at dilution of 1:100 (40x lens).)

product-image-AAA28394_IHC3.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded HepG2 cells treated by oleic acid using β-Tubulin antibody at dilution of 1:100 (40x lens).)

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded HepG2 cells using β-Tubulin antibody at dilution of 1:100 (40x lens).)

product-image-AAA28394_IHC2.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded HepG2 cells using β-Tubulin antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using TUBB antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)

product-image-AAA28394_WB.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using TUBB antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 3s.)
Related Product Information for anti-TUBB antibody
Background: This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
444
NCBI Official Full Name
tubulin beta chain
NCBI Official Synonym Full Names
tubulin, beta class I
NCBI Official Symbol
TUBB
NCBI Official Synonym Symbols
M40; TUBB1; TUBB5; OK/SW-cl.56
NCBI Protein Information
tubulin beta chain; beta1-tubulin; beta 5-tubulin; beta-4 tubulin; beta Ib tubulin; class I beta-tubulin; tubulin beta-1 chain; tubulin beta-5 chain; tubulin beta polypeptide; tubulin, beta polypeptide
UniProt Protein Name
Tubulin beta chain
UniProt Gene Name
TUBB
UniProt Synonym Gene Names
TUBB5
UniProt Entry Name
TBB5_HUMAN

Similar Products

Product Notes

The TUBB tubb (Catalog #AAA28394) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The beta-Tubulin Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's beta-Tubulin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF). WB: 1:500-1:2000 IHC: 1:50-1:200 IF: 1:50-1:200 Customer Validation: WB: Mouse, Rat, Human, Bos taurus IP: Human WB: Human. Researchers should empirically determine the suitability of the TUBB tubb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SDLQLERISV YYNEASSHKY VPRAILVDLE PGTMDSVRSG AFGHLFRPDN FIFGQSGAGN NWAKGHYTEG AELVDSVLDV VRKECENCDC LQGFQLTHSL GGGTGSGMGT LLISKVREEY PDRIMNTFSV VPSPKVSDTV VEPYNATLSI HQLVENTDET YCIDNEALYD ICFRTLKLAT PTYGDLNHLV SATMSGVTTS LRFPGQLNAD LRKLAVNMVP F. It is sometimes possible for the material contained within the vial of "beta-Tubulin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.