Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201053_WB13.jpg WB (Western Blot) (WB Suggested Anti-BID AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit BID Polyclonal Antibody | anti-BID antibody

BID antibody - C-terminal region

Gene Names
BID; FP497
Reactivity
Dog, Horse, Human, Rat
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Synonyms
BID, Antibody; BID antibody - C-terminal region; anti-BID antibody
Ordering
Host
Rabbit
Reactivity
Dog, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASH
Sequence Length
241
Applicable Applications for anti-BID antibody
WB (Western Blot), IF (Immunofluorescence)
Homology
Dog: 86%; Horse: 86%; Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-BID AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

product-image-AAA201053_WB13.jpg WB (Western Blot) (WB Suggested Anti-BID AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

IF (Immunofluorescence)

(Sample Type :Rat thyrocytes-FRTL-5 Primary Antibody Dilution :1:100 Secondary Antibody :Anti-rabbit-FITC Secondary Antibody Dilution :1:100 Color/Signal Descriptions :Green: BIDBlue: DAPIGene Name :BIDSubmitted by :Syed A Morshed, Mount Sinai School of Medicine and James J Peters VA Medical Center)

product-image-AAA201053_IF15.jpg IF (Immunofluorescence) (Sample Type :Rat thyrocytes-FRTL-5 Primary Antibody Dilution :1:100 Secondary Antibody :Anti-rabbit-FITC Secondary Antibody Dilution :1:100 Color/Signal Descriptions :Green: BIDBlue: DAPIGene Name :BIDSubmitted by :Syed A Morshed, Mount Sinai School of Medicine and James J Peters VA Medical Center)
Related Product Information for anti-BID antibody
This is a rabbit polyclonal antibody against BID. It was validated on Western Blot

Target Description: This gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found, but the full-length nature of some variants has not been defined.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
637
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
BH3-interacting domain death agonist isoform 1
NCBI Official Synonym Full Names
BH3 interacting domain death agonist
NCBI Official Symbol
BID
NCBI Official Synonym Symbols
FP497
NCBI Protein Information
BH3-interacting domain death agonist

Similar Products

Product Notes

The BID (Catalog #AAA201053) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BID antibody - C-terminal region reacts with Dog, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's BID can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IF (Immunofluorescence). Researchers should empirically determine the suitability of the BID for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LRNTSRSEED RNRDLATALE QLLQAYPRDM EKEKTMLVLA LLLAKKVASH. It is sometimes possible for the material contained within the vial of "BID, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.