Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA198898_WB11.jpg WB (Western Blot) (WB Suggested Anti-CA4 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Rabbit CA4 Polyclonal Antibody | anti-CA4 antibody

CA4 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
CA4; CAIV; Car4; RP17
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CA4, Antibody; CA4 antibody - C-terminal region; anti-CA4 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AFSQKLYYDKEQTVSMKDNVRPLQQLGQRTVIKSGAPGRPLPWALPALLG
Sequence Length
312
Applicable Applications for anti-CA4 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Cow: 83%; Guinea Pig: 92%; Horse: 83%; Human: 100%; Mouse: 85%; Rabbit: 85%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CA4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CA4 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

product-image-AAA198898_WB11.jpg WB (Western Blot) (WB Suggested Anti-CA4 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

WB (Western Blot)

(Host: RabbitTarget Name: CA4Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)

product-image-AAA198898_WB13.jpg WB (Western Blot) (Host: RabbitTarget Name: CA4Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)

IHC (Immunohistochemistry)

(Sample Type: Human Lung TissueCA4 antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasm and membrane of alveolar macrophagesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA198898_IHC15.jpg IHC (Immunohistochemistry) (Sample Type: Human Lung TissueCA4 antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Lung TissueObserved Staining: Cytoplasm and membrane of alveolar macrophagesPrimary Antibody Concentration: 1:600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-CA4 antibody
This is a rabbit polyclonal antibody against CA4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA4 is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA IV is a glycosylphosphatidyl-inositol-anchored membrane isozyme expressed on the luminal surfaces of pulmonary (and certain other) capillaries and of proximal renal tubules. Its exact function is not known, however, it may have a role in inherited renal abnormalities of bicarbonate transport.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
762
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
carbonic anhydrase 4 preproprotein
NCBI Official Synonym Full Names
carbonic anhydrase 4
NCBI Official Symbol
CA4
NCBI Official Synonym Symbols
CAIV; Car4; RP17
NCBI Protein Information
carbonic anhydrase 4
UniProt Protein Name
Carbonic anhydrase 4
UniProt Gene Name
CA4
UniProt Synonym Gene Names
CA-IV
UniProt Entry Name
CAH4_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CA4 ca4 (Catalog #AAA198898) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CA4 antibody - C-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CA4 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CA4 ca4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AFSQKLYYDK EQTVSMKDNV RPLQQLGQRT VIKSGAPGRP LPWALPALLG. It is sometimes possible for the material contained within the vial of "CA4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.