Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199628_WB8.jpg WB (Western Blot) (WB Suggested Anti-CCT8 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate.CCT8 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit CCT8 Polyclonal Antibody | anti-CCT8 antibody

CCT8 antibody - C-terminal region

Average rating 0.0
No ratings yet
Gene Names
CCT8; Cctq; PRED71; D21S246; C21orf112
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CCT8, Antibody; CCT8 antibody - C-terminal region; anti-CCT8 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK
Sequence Length
548
Applicable Applications for anti-CCT8 antibody
WB (Western Blot)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Yeast: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CCT8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CCT8 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate.CCT8 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

product-image-AAA199628_WB8.jpg WB (Western Blot) (WB Suggested Anti-CCT8 Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate.CCT8 is strongly supported by BioGPS gene expression data to be expressed in Jurkat)

WB (Western Blot)

(Host: RabbitTarget Name: CCT8Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

product-image-AAA199628_WB10.jpg WB (Western Blot) (Host: RabbitTarget Name: CCT8Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Host: MouseTarget Name: CCT8Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

product-image-AAA199628_WB11.jpg WB (Western Blot) (Host: MouseTarget Name: CCT8Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)

WB (Western Blot)

(Sample Type: Human lymphoblastoid, Mouse brainCCT8 antibody - C-terminal region validated by WB using human lymphoblastoid & mouse brain)

product-image-AAA199628_WB13.jpg WB (Western Blot) (Sample Type: Human lymphoblastoid, Mouse brainCCT8 antibody - C-terminal region validated by WB using human lymphoblastoid & mouse brain)

WB (Western Blot)

(Sample Type: Human HEK293TCCT8 antibody - C-terminal region validated by WB using HEK 293T at 1:1,000 dilution for antibody samples and 1:10,000 for secondary antibodies.CCT8 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

product-image-AAA199628_WB15.jpg WB (Western Blot) (Sample Type: Human HEK293TCCT8 antibody - C-terminal region validated by WB using HEK 293T at 1:1,000 dilution for antibody samples and 1:10,000 for secondary antibodies.CCT8 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Related Product Information for anti-CCT8 antibody
This is a rabbit polyclonal antibody against CCT8. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: As a molecular chaperone; CCT8 assists the folding of proteins upon ATP hydrolysis. It is known to play a role, in vitro, in the folding of actin and tubulin.
Product Categories/Family for anti-CCT8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
T-complex protein 1 subunit theta isoform 1
NCBI Official Synonym Full Names
chaperonin containing TCP1 subunit 8
NCBI Official Symbol
CCT8
NCBI Official Synonym Symbols
Cctq; PRED71; D21S246; C21orf112
NCBI Protein Information
T-complex protein 1 subunit theta
UniProt Protein Name
T-complex protein 1 subunit theta
UniProt Gene Name
CCT8
UniProt Synonym Gene Names
TCP-1-theta

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CCT8 cct8 (Catalog #AAA199628) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCT8 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's CCT8 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CCT8 cct8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DMLEAGILDT YLGKYWAIKL ATNAAVTVLR VDQIIMAKPA GGPKPPSGKK. It is sometimes possible for the material contained within the vial of "CCT8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.