Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46235_IHC13.jpg IHC (Immunohiostchemistry) (Anti-CD19 Picoband antibody, AAA46235, IHC(P)IHC(P): Human Tonsil Tissue)

anti-Human CD19 Polyclonal Antibody | anti-CD19 antibody

Anti-CD19 Antibody

Average rating 0.0
No ratings yet
Gene Names
CD19; B4; CVID3
Reactivity
Human
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
CD19, Antibody; Anti-CD19 Antibody; B-lymphocyte antigen CD19; Antibody deficiency due to defect in CD19, included; AW495831; B lymphocyte antigen CD19; B lymphocyte surface antigen B4; B-lymphocyte surface antigen B4; B4; CD19; CD19 antigen; CD19 molecule; Cd19 protein; CD19_HUMAN; CVID3; Differentiation antigen CD19; Leu 12; Leu-12; Leu12; MGC109570; MGC12802; T-cell surface antigen Leu-12; anti-CD19 antibody
Ordering
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
557
Applicable Applications for anti-CD19 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human CD19 (307-337aa LVGILHLQRALVLRRKRKRMTDPTRRFFKVT), different from the related mouse sequence by seven amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohiostchemistry)

(Anti-CD19 Picoband antibody, AAA46235, IHC(P)IHC(P): Human Tonsil Tissue)

product-image-AAA46235_IHC13.jpg IHC (Immunohiostchemistry) (Anti-CD19 Picoband antibody, AAA46235, IHC(P)IHC(P): Human Tonsil Tissue)

WB (Western Blot)

(Anti-CD19 Picoband antibody, AAA46235, Western blottingAll lanes: Anti CD19 (AAA46235) at 0.5ug/mlLane 1: RAJI Whole Cell Lysate at 40ugLane 2: A549 Whole Cell Lysate at 40ugLane 3: MCF-7 Whole Cell Lysate at 40ugLane 4: SW620 Whole Cell Lysate at 40ugPredicted bind size: 90KDObserved bind size: 90KD)

product-image-AAA46235_WB15.jpg WB (Western Blot) (Anti-CD19 Picoband antibody, AAA46235, Western blottingAll lanes: Anti CD19 (AAA46235) at 0.5ug/mlLane 1: RAJI Whole Cell Lysate at 40ugLane 2: A549 Whole Cell Lysate at 40ugLane 3: MCF-7 Whole Cell Lysate at 40ugLane 4: SW620 Whole Cell Lysate at 40ugPredicted bind size: 90KDObserved bind size: 90KD)
Related Product Information for anti-CD19 antibody
Description: Rabbit IgG polyclonal antibody for B-lymphocyte antigen CD19(CD19) detection. Tested with WB, IHC-P in Human.

Background: B-lymphocyte antigen CD19, also known as CD19 (Cluster of Differentiation 19), is a protein that in humans is encoded by the CD19 gene. It is found on the surface of B-cells, a type of white blood cell. Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. The CD19 gene encodes a cell surface molecule that assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.
References
1. "Entrez Gene: CD19 CD19 molecule". 2. Pesando JM, Bouchard LS, McMaster BE (Dec 1989). "CD19 is functionally and physically associated with surface immunoglobulin". The Journal of Experimental Medicine 170 (6): 2159-64. 3. Tedder TF, Isaacs CM (Jul 1989). "Isolation of cDNAs encoding the CD19 antigen of human and mouse B lymphocytes. A new member of the immunoglobulin superfamily". Journal of Immunology 143 (2): 712-7.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
930
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61,200 Da
NCBI Official Full Name
B-lymphocyte antigen CD19 isoform 1
NCBI Official Synonym Full Names
CD19 molecule
NCBI Official Symbol
CD19
NCBI Official Synonym Symbols
B4; CVID3
NCBI Protein Information
B-lymphocyte antigen CD19
UniProt Protein Name
B-lymphocyte antigen CD19
UniProt Gene Name
CD19
UniProt Entry Name
CD19_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CD19 cd19 (Catalog #AAA46235) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-CD19 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD19 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CD19 cd19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.