Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA199862_WB10.jpg WB (Western Blot) (WB Suggested Anti-CD36 Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit CD36 Polyclonal Antibody | anti-CD36 antibody

CD36 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
CD36; FAT; GP4; GP3B; GPIV; CHDS7; PASIV; SCARB3; BDPLT10
Reactivity
Cow, Dog, Goat, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Affinity Purified
Synonyms
CD36, Antibody; CD36 antibody - N-terminal region; anti-CD36 antibody
Ordering
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MGCDRNCGLIAGAVIGAVLAVFGGILMPVGDLLIQKTIKKQVVLEEGTIA
Sequence Length
472
Applicable Applications for anti-CD36 antibody
WB (Western Blot), IHC (Immunohistochemistry)
Homology
Cow: 79%; Dog: 79%; Goat: 79%; Horse: 79%; Human: 100%; Pig: 79%; Rabbit: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human CD36
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CD36 Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysate)

product-image-AAA199862_WB10.jpg WB (Western Blot) (WB Suggested Anti-CD36 Antibody Titration: 1 ug/mlPositive Control: HepG2 cell lysate)

WB (Western Blot)

(Host: RabbitTarget Name: CD36Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

product-image-AAA199862_WB11.jpg WB (Western Blot) (Host: RabbitTarget Name: CD36Sample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)

IHC (Immunohiostchemistry)

(Rabbit Anti-CD36 AntibodyParaffin Embedded Tissue: Human hepatocyteCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

product-image-AAA199862_IHC13.jpg IHC (Immunohiostchemistry) (Rabbit Anti-CD36 AntibodyParaffin Embedded Tissue: Human hepatocyteCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

IHC (Immunohistochemistry)

(Immunohistochemistry with HepG2 cell lysate tissue at an antibody concentration of 1 ug/ml using anti-CD36 antibody)

product-image-AAA199862_IHC15.jpg IHC (Immunohistochemistry) (Immunohistochemistry with HepG2 cell lysate tissue at an antibody concentration of 1 ug/ml using anti-CD36 antibody)
Related Product Information for anti-CD36 antibody
This is a rabbit polyclonal antibody against CD36. It was validated on Western Blot and immunohistochemistry

Target Description: CD36 is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in its gene cause platelet glycoprotein deficiency.The protein encoded by this gene is the fourth major glycoprotein of the platelet surface and serves as a receptor for thrombospondin in platelets and various cell lines. Since thrombospondins are widely distributed proteins involved in a variety of adhesive processes, this protein may have important functions as a cell adhesion molecule. It binds to collagen, thrombospondin, anionic phospholipids and oxidized LDL. It directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes and it binds long chain fatty acids and may function in the transport and/or as a regulator of fatty acid transport. Mutations in this gene cause platelet glycoprotein deficiency. Three alternatively spliced transcript variants encoding the same protein isoform have been found for this gene.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
948
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53kDa
NCBI Official Full Name
platelet glycoprotein 4 isoform 1
NCBI Official Synonym Full Names
CD36 molecule
NCBI Official Symbol
CD36
NCBI Official Synonym Symbols
FAT; GP4; GP3B; GPIV; CHDS7; PASIV; SCARB3; BDPLT10
NCBI Protein Information
platelet glycoprotein 4
UniProt Protein Name
Platelet glycoprotein 4
UniProt Gene Name
CD36
UniProt Synonym Gene Names
GP3B; GP4; FAT; GPIIIB; GPIV
UniProt Entry Name
CD36_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CD36 cd36 (Catalog #AAA199862) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD36 antibody - N-terminal region reacts with Cow, Dog, Goat, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CD36 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CD36 cd36 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MGCDRNCGLI AGAVIGAVLA VFGGILMPVG DLLIQKTIKK QVVLEEGTIA. It is sometimes possible for the material contained within the vial of "CD36, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.