<
IHC (Immunohistochemistry)
(CD36 Antibody-Human Heart: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.)
Rabbit CD36 Polyclonal Antibody | anti-CD36 antibody
CD36 Rabbit anti-Human Polyclonal Antibody
Gene Names
CD36; FAT; GP4; GP3B; GPIV; CHDS7; PASIV; SCARB3; BDPLT10
Reactivity
Mouse, Rat, Human
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry
Purity
Affinity purified
Synonyms
CD36, Antibody; CD36 Rabbit anti-Human Polyclonal Antibody; PathPlus CD36 Antibody; CD36; Cluster determinant 36; FAT; Fatty acid translocase; Glycoprotein IIIb; gp4; GPIIIB; GPIV; PAS-4 protein; PAS IV; PASIV; Platelet collagen receptor; Platelet glycoprotein IV; SCARB3; Thrombospondin receptor; BDPLT10; CD36 antigen; CHDS7; gp3B; PAS-4; Platelet glycoprotein 4; anti-CD36 antibody
Host
Rabbit
Reactivity
Mouse, Rat, Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Human CD36
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Applicable Applications for anti-CD36 antibody
WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry)
Target
Human CD36
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 301-400 of human CD36 (NP_001120916.1). ASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQ
Conjugation
Unconjugated
Preparation and Storage
Short term: -20 degree C; Long term: -80 degree C; Avoid freeze-thaw cycles.
IHC (Immunohistochemistry)
(CD36 Antibody-Human Heart: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.)
IHC (Immunohistochemistry)
(CD36 Antibody-Human Heart: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.)
IHC (Immunohistochemistry)
(CD36 Antibody-Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.)
IHC (Immunohistochemistry)
(CD36 Antibody-Human Placenta: Formalin-Fixed, Paraffin-Embedded (FFPE), at a dilution of 1:200.)
IHC (Immunohistochemisry)
(CD36 Antibody-Human Bone Marrow, Megakaryocytes: Formalin-Fixed, Paraffin-Embedded (FFPE))
IHC (Immunohistochemisry)
(CD36 Antibody-Human Bone Marrow, Megakaryocytes: Formalin-Fixed, Paraffin-Embedded (FFPE))
WB (Western Blot)
(CD36 Antibody-Western blot analysis of extracts of RAW264.7 cells lines, using CD36 antibody.)
WB (Western Blot)
(CD36 Antibody-Western blot analysis of extracts of RAW264.7 cells lines, using CD36 antibody.)
WB (Western Blot)
(CD36 Antibody-Western blot analysis of extracts of various cell lines, using CD36 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.)
WB (Western Blot)
(CD36 Antibody-Western blot analysis of extracts of various cell lines, using CD36 antibody at 1:3000 dilution. The secondary antibody used was an HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates were loaded 25ug per lane and 3% nonfat dry milk in TBST was used for blocking. An ECL Kit was used for detection and the exposure time was 90s.)
Related Product Information for anti-CD36 antibody
CD36 antibody is an unconjugated rabbit polyclonal antibody to CD36 from human. It is reactive with human, mouse and rat. Validated for IHC and WB.
CD36 (also known as platelet glycoprotein 4) is a multifunctional membrane-bound glycoprotein receptor for a broad range of ligands. It is a scavenger receptor for proteins such as thrombospondin, collagen, fibronectin, and amyloid-beta as well as oxidized phospholipids, apoptotic cells, and microbial pathogens, acting to internalize receptor-ligand complexes. It is implicated in platelet disorders, atherosclerosis, thrombosis, and Alzheimer disease. CD36 is found on mononuclear phagocytes, platelets, adipocytes, megakaryocytes, erythroid precursors, myocytes, hepatocytes, endothelial cells, and some epithelia. It has also been reported to be expressed in some diseased tissues such as the brain in Alzheimer disease, leukemias, myxoid liposarcoma, and squamous intraepithelial lesions of the cervix.
CD36 (also known as platelet glycoprotein 4) is a multifunctional membrane-bound glycoprotein receptor for a broad range of ligands. It is a scavenger receptor for proteins such as thrombospondin, collagen, fibronectin, and amyloid-beta as well as oxidized phospholipids, apoptotic cells, and microbial pathogens, acting to internalize receptor-ligand complexes. It is implicated in platelet disorders, atherosclerosis, thrombosis, and Alzheimer disease. CD36 is found on mononuclear phagocytes, platelets, adipocytes, megakaryocytes, erythroid precursors, myocytes, hepatocytes, endothelial cells, and some epithelia. It has also been reported to be expressed in some diseased tissues such as the brain in Alzheimer disease, leukemias, myxoid liposarcoma, and squamous intraepithelial lesions of the cervix.
References
Sci Signal. 2009;2(72):re3. doi: 10.1126/scisignal.272re3; Trans Am Clin Climatol Assoc. 2010;121:206-220. PMID: 20697562; Am J Pathol. 2002;160(1):101-112. PMID: 11786404; Mod Pathol. 1998;11(12):1211-1221. PMID: 9872654; Hum Pathol. 1994;25(1):73-79. PMID: 7508885; Am J Clin Pathol. 1995;103(1):20-26. doi: 10.1093/ajcp/103.1.20;
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46,090 Da
NCBI Official Full Name
platelet glycoprotein 4 isoform 1
NCBI Official Synonym Full Names
CD36 molecule
NCBI Official Symbol
CD36
NCBI Official Synonym Symbols
FAT; GP4; GP3B; GPIV; CHDS7; PASIV; SCARB3; BDPLT10
NCBI Protein Information
platelet glycoprotein 4
UniProt Protein Name
Platelet glycoprotein 4
UniProt Gene Name
CD36
UniProt Synonym Gene Names
GP3B; GP4; FAT; GPIIIB; GPIV
UniProt Entry Name
CD36_HUMAN
Similar Products
Product Notes
The CD36 cd36 (Catalog #AAA162824) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD36 Rabbit anti-Human Polyclonal Antibody reacts with Mouse, Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's CD36 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IHC (Immunohistochemistry). Researchers should empirically determine the suitability of the CD36 cd36 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD36, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.