<
IF (Immunofluorescence)
(Immunofluorescence analysis of Raw264.7 cells using CD44 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Rabbit CD44 Polyclonal Antibody | anti-CD44 antibody
CD44 Rabbit pAb
Gene Names
NUCKS1; JC7; NUCKS
Reactivity
Human, Mouse, Rat
Applications
Immunocytochemistry, Immunofluorescence
Purity
Affinity purification
Synonyms
CD44, Antibody; CD44 Rabbit pAb; CDW44; CSPG8; ECMR-III; HCELL; HUTCH-I; IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CD44; anti-CD44 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
ASKQREMLMEDVGSEEEQEEEDEAPFQEKDSGSDEDFLMEDDDDSDYGSSKKKNKKMVKKSKPERKEKKMPKPRLKATVTPSPVKGKGKVGRPTASKASKE
Applicable Applications for anti-CD44 antibody
ICC (Immunocytochemistry), IF (Immunofluorescence)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 148-247 of human CD44 (NP_001189486.1).
Cellular Location
Cell membrane, Single-pass type I membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of Raw264.7 cells using CD44 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of Raw264.7 cells using CD44 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of HUVEC cells using CD44 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of HUVEC cells using CD44 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of HeLa cells using CD44 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of HeLa cells using CD44 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of C6 cells using CD44 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of C6 cells using CD44 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.)
Related Product Information for anti-CD44 antibody
The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis.
Product Categories/Family for anti-CD44 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
27,296 Da
NCBI Official Full Name
nuclear ubiquitous casein and cyclin-dependent kinase substrate 1
NCBI Official Synonym Full Names
nuclear casein kinase and cyclin-dependent kinase substrate 1
NCBI Official Symbol
NUCKS1
NCBI Official Synonym Symbols
JC7; NUCKS
NCBI Protein Information
nuclear ubiquitous casein and cyclin-dependent kinase substrate 1; P1; potential LAG1 interactor; nuclear ubiquitous casein kinase and cyclin-dependent kinase substrate
UniProt Protein Name
Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1
UniProt Gene Name
NUCKS1
UniProt Synonym Gene Names
NUCKS
UniProt Entry Name
NUCKS_HUMAN
Similar Products
Product Notes
The CD44 nucks1 (Catalog #AAA282331) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD44 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CD44 can be used in a range of immunoassay formats including, but not limited to, ICC (Immunocytochemistry), IF (Immunofluorescence). Researchers should empirically determine the suitability of the CD44 nucks1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ASKQREMLME DVGSEEEQEE EDEAPFQEKD SGSDEDFLME DDDDSDYGSS KKKNKKMVKK SKPERKEKKM PKPRLKATVT PSPVKGKGKV GRPTASKASK E. It is sometimes possible for the material contained within the vial of "CD44, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.