Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA201079_WB15.jpg WB (Western Blot) (WB Suggested Anti-CD70 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellCD70 is supported by BioGPS gene expression data to be expressed in ACHN)

Rabbit CD70 Polyclonal Antibody | anti-CD70 antibody

CD70 antibody - N-terminal region

Average rating 0.0
No ratings yet
Gene Names
CD70; CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A
Reactivity
Reactivity: Human
Predicted Species Reactivity: Cow, Guinea Pig, Horse, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD70, Antibody; CD70 antibody - N-terminal region; CD27L; CD27LG; TNFSF7; anti-CD70 antibody
Ordering
Host
Rabbit
Reactivity
Reactivity: Human
Predicted Species Reactivity: Cow, Guinea Pig, Horse, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
100 ul at 0.5-1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: VICLVVCIQRFAQAQQQLPLESLGWDVAELQLNHTGPQQDPRLYWQGGPA
Sequence Length
193
Applicable Applications for anti-CD70 antibody
WB (Western Blot)
Homology
Cow: 85%; Guinea Pig: 85%; Horse: 77%; Human: 100%; Rabbit: 85%
Protein Name
CD70 antigen
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CD70 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellCD70 is supported by BioGPS gene expression data to be expressed in ACHN)

product-image-AAA201079_WB15.jpg WB (Western Blot) (WB Suggested Anti-CD70 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole CellCD70 is supported by BioGPS gene expression data to be expressed in ACHN)
Related Product Information for anti-CD70 antibody
This is a rabbit polyclonal antibody against CD70. It was validated on Western Blot

Target Description: The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF27/CD27. It is a surface antigen on activated, but not on resting, T and B lymphocytes. It induces proliferation of costimulated T cells, enhances the generation of cytolytic T cells, and contributes to T cell activation. This cytokine is also reported to play a role in regulating B-cell activation, cytotoxic function of natural killer cells, and immunoglobulin sythesis.
Product Categories/Family for anti-CD70 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
970
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
CD70 antigen isoform 1
NCBI Official Synonym Full Names
CD70 molecule
NCBI Official Symbol
CD70
NCBI Official Synonym Symbols
CD27L; LPFS3; CD27-L; CD27LG; TNFSF7; TNLG8A
NCBI Protein Information
CD70 antigen
UniProt Protein Name
CD70 antigen
UniProt Gene Name
CD70
UniProt Synonym Gene Names
CD27L; CD27LG; TNFSF7; CD27-L
UniProt Entry Name
CD70_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CD70 cd70 (Catalog #AAA201079) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD70 antibody - N-terminal region reacts with Reactivity: Human Predicted Species Reactivity: Cow, Guinea Pig, Horse, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's CD70 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CD70 cd70 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VICLVVCIQR FAQAQQQLPL ESLGWDVAEL QLNHTGPQQD PRLYWQGGPA. It is sometimes possible for the material contained within the vial of "CD70, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.