WB (Western Blot)
(Western blot analysis of lysates from Rat brain, using CD81 Rabbit pAb (AAA283200) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Rabbit anti-Mouse CD81 Polyclonal Antibody | anti-Cd81 antibody
CD81 Rabbit pAb
Reactivity
Mouse
Applications
ELISA, Western Blot
Purity
Affinity purification
Synonyms
CD81, Antibody; CD81 Rabbit pAb; Tapa1; Tapa-1; Tspan28; CD81; anti-Cd81 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Sequence
VAAGIWGFVNKDQIAKDVKQFYDQALQQAVMDDDANNAKAVVKTFHETLNCCGSNALTTLTTTILRNSLCPSGGNILTPLLQQDCHQKIDELFSGKLYLIGIAAIV
Applicable Applications for anti-Cd81 antibody
ELISA, WB (Western Blot)
Cross Reactivity
Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 106-211 of mouse CD81(NP_598416.1).
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
WB (Western Blot)
(Western blot analysis of lysates from Rat brain, using CD81 Rabbit pAb (AAA283200) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
WB (Western Blot)
(Western blot analysis of lysates from Rat brain, using CD81 Rabbit pAb (AAA283200) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
WB (Western Blot)
(Western blot analysis of lysates from Mouse brain, using CD81 Rabbit pAb (AAA283200) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
WB (Western Blot)
(Western blot analysis of lysates from Mouse brain, using CD81 Rabbit pAb (AAA283200) at 1:2000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5s.)
Related Product Information for anti-Cd81 antibody
Predicted to enable cholesterol binding activity; signaling receptor binding activity; and virus receptor activity. Involved in several processes, including cellular response to low-density lipoprotein particle stimulus; positive regulation of immune response; and syncytium formation by plasma membrane fusion. Acts upstream of or within regulation of cell motility. Located in membrane. Is expressed in several structures, including alimentary system; extraembryonic component; genitourinary system; nervous system; and sensory organ. Human ortholog(s) of this gene implicated in common variable immunodeficiency. Orthologous to human CD81 (CD81 molecule).
Product Categories/Family for anti-Cd81 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated MW: 25kDa
Observed MW: 22kDa
Observed MW: 22kDa
UniProt Protein Name
CD81 antigen
UniProt Gene Name
Cd81
UniProt Synonym Gene Names
Tapa1
UniProt Entry Name
CD81_MOUSE
Similar Products
Product Notes
The Cd81 cd81 (Catalog #AAA283200) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD81 Rabbit pAb reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's CD81 can be used in a range of immunoassay formats including, but not limited to, ELISA, WB (Western Blot). Researchers should empirically determine the suitability of the Cd81 cd81 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: VAAGIWGFVN KDQIAKDVKQ FYDQALQQAV MDDDANNAKA VVKTFHETLN CCGSNALTTL TTTILRNSLC PSGGNILTPL LQQDCHQKID ELFSGKLYLI GIAAIV. It is sometimes possible for the material contained within the vial of "CD81, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.