Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA281201_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human skin using CDH3 antibody at dilution of 1:100 (40x lens).)

Rabbit CDH3 Polyclonal Antibody | anti-CDH3 antibody

CDH3 Polyclonal Antibody

Average rating 0.0
No ratings yet
Gene Names
CDH3; CDHP; HJMD; PCAD
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purification
Synonyms
CDH3, Antibody; CDH3 Polyclonal Antibody; CDHP; HJMD; PCAD; anti-CDH3 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
SEPCRAVFREAEVTLEAGGAEQEPGQALGKVFMGCPGQEPALFSTDNDDFTVRNGETVQERRSLKERNPLKIFPSKRILRRHKRDWVVAPISVPENGKGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGT
Sequence Length
784
Applicable Applications for anti-CDH3 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
Recombinant protein of human CDH3
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Single-pass type I membrane protein
Positive Samples
Mouse brain, Rat testis, Rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human skin using CDH3 antibody at dilution of 1:100 (40x lens).)

product-image-AAA281201_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human skin using CDH3 antibody at dilution of 1:100 (40x lens).)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using CDH3 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)

product-image-AAA281201_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using CDH3 antibody at 1:3000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-CDH3 antibody
This gene encodes a classical cadherin of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature glycoprotein. This calcium-dependent cell-cell adhesion protein is comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. This gene is located in a gene cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. In addition, aberrant expression of this protein is observed in cervical adenocarcinomas. Mutations in this gene are associated with hypotrichosis with juvenile macular dystrophy and ectodermal dysplasia, ectrodactyly, and macular dystrophy syndrome (EEMS).
Product Categories/Family for anti-CDH3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 86kDa; 91kDa
Observed: 115kDa
NCBI Official Full Name
cadherin-3 isoform 2
NCBI Official Synonym Full Names
cadherin 3
NCBI Official Symbol
CDH3
NCBI Official Synonym Symbols
CDHP; HJMD; PCAD
NCBI Protein Information
cadherin-3
UniProt Protein Name
Cadherin-3
UniProt Gene Name
CDH3
UniProt Synonym Gene Names
CDHP; P-cadherin

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CDH3 cdh3 (Catalog #AAA281201) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDH3 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CDH3 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CDH3 cdh3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SEPCRAVFRE AEVTLEAGGA EQEPGQALGK VFMGCPGQEP ALFSTDNDDF TVRNGETVQE RRSLKERNPL KIFPSKRILR RHKRDWVVAP ISVPENGKGP FPQRLNQLKS NKDRDTKIFY SITGPGADSP PEGVFAVEKE TGWLLLNKPL DREEIAKYEL FGHAVSENGA SVEDPMNISI IVTDQNDHKP KFTQDTFRGS VLEGVLPGTS VMQVTATDED DAIYTYNGVV AYSIHSQEPK DPHDLMFTIH RSTGT. It is sometimes possible for the material contained within the vial of "CDH3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.