IF (Immunofluorescence)
(Immunofluorescence analysis of 293T-CD299 cells using CLEC4M Rabbit pAb (AAA281202) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
Rabbit CLEC4M Polyclonal Antibody | anti-CLEC4M antibody
CLEC4M Polyclonal Antibody
Gene Names
CLEC4M; CD299; LSIGN; CD209L; L-SIGN; DCSIGNR; HP10347; DC-SIGN2; DC-SIGNR
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
CLEC4M, Antibody; CLEC4M Polyclonal Antibody; CD209L; CD299; DC-SIGN2; DC-SIGNR; DCSIGNR; HP10347; L-SIGN; LSIGN; anti-CLEC4M antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
YFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDE
Sequence Length
375
Applicable Applications for anti-CLEC4M antibody
WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CLEC4M (NP_055072.3).
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
IF (Immunofluorescence)
(Immunofluorescence analysis of 293T-CD299 cells using CLEC4M Rabbit pAb (AAA281202) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of 293T-CD299 cells using CLEC4M Rabbit pAb (AAA281202) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of 293T cells using CLEC4M Rabbit pAb (AAA281202) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
IF (Immunofluorescence)
(Immunofluorescence analysis of 293T cells using CLEC4M Rabbit pAb (AAA281202) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)
WB (Western Blot)
(Western blot analysis of extracts of HepG2 cells, using CLEC4M antibody (AAA281202) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25?g per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
WB (Western Blot)
(Western blot analysis of extracts of HepG2 cells, using CLEC4M antibody (AAA281202) at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25?g per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 90s.)
Related Product Information for anti-CLEC4M antibody
This gene encodes a C-type lectin that functions in cell adhesion and pathogen recognition. This receptor recognizes a wide range of evolutionarily divergent pathogens with a large impact on public health, including tuberculosis mycobacteria, and viruses including Ebola, hepatitis C, HIV-1, influenza A, West Nile virus and the SARS-CoV acute respiratory syndrome coronavirus. The protein is organized into four distinct domains: a C-terminal carbohydrate recognition domain, a flexible tandem-repeat neck domain of variable length, a transmembrane region and an N-terminal cytoplasmic domain involved in internalization. This gene is closely related in terms of both sequence and function to a neighboring gene, CD209 (Gene ID: 30835), also known as DC-SIGN. The two genes differ in viral recognition and expression patterns, with this gene showing high expression in endothelial cells of the liver, lymph node and placenta. Polymorphisms in the tandem repeat neck domain are associated with resistance to SARS infection.
Product Categories/Family for anti-CLEC4M antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 45kDa
Observed: 45kDa
Observed: 45kDa
NCBI Official Full Name
C-type lectin domain family 4 member M isoform 12
NCBI Official Synonym Full Names
C-type lectin domain family 4 member M
NCBI Official Symbol
CLEC4M
NCBI Official Synonym Symbols
CD299; LSIGN; CD209L; L-SIGN; DCSIGNR; HP10347; DC-SIGN2; DC-SIGNR
NCBI Protein Information
C-type lectin domain family 4 member M
UniProt Protein Name
C-type lectin domain family 4 member M
UniProt Gene Name
CLEC4M
UniProt Synonym Gene Names
CD209L; CD209L1; CD299; DC-SIGNR; DC-SIGN2; L-SIGN
Similar Products
Product Notes
The CLEC4M clec4m (Catalog #AAA281202) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CLEC4M Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CLEC4M can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the CLEC4M clec4m for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YFMSNSQRNW HDSVTACQEV RAQLVVIKTA EEQNFLQLQT SRSNRFSWMG LSDLNQEGTW QWVDGSPLSP SFQRYWNSGE PNNSGNEDCA EFSGSGWNDN RCDVDNYWIC KKPAACFRDE. It is sometimes possible for the material contained within the vial of "CLEC4M, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.