Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA224239_IHC13.jpg IHC (Immunohiostchemistry) (Cobl-Like 1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

Rabbit Cobl-Like 1 Polyclonal Antibody | anti-COBLL1 antibody

Cobl-Like 1 antibody

Gene Names
COBLL1; COBLR1
Reactivity
Human, Mouse, Rat, Dog
Applications
Immunohistochemistry, Western Blot
Purity
Affinity purified
Synonyms
Cobl-Like 1, Antibody; Cobl-Like 1 antibody; Polyclonal Cobl-Like 1; Anti-Cobl-Like 1; KIAA0977; COBLL1; anti-COBLL1 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat, Dog
Clonality
Polyclonal
Specificity
Cobl-Like 1 antibody was raised against the N terminal of COBLL1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of COBLL1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
1233
Applicable Applications for anti-COBLL1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Biological Significance
The function of this gene remains unknown.
Cross-Reactivity
Human,Mouse,Rat,Dog
Immunogen
Cobl-Like 1 antibody was raised using the N terminal of COBLL1 corresponding to a region with amino acids SAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

IHC (Immunohiostchemistry)

(Cobl-Like 1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

product-image-AAA224239_IHC13.jpg IHC (Immunohiostchemistry) (Cobl-Like 1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X)

WB (Western Blot)

(Cobl-Like 1 antibody (AAA224239) used at 0.5 ug/ml to detect target protein.)

product-image-AAA224239_WB15.jpg WB (Western Blot) (Cobl-Like 1 antibody (AAA224239) used at 0.5 ug/ml to detect target protein.)
Related Product Information for anti-COBLL1 antibody
Rabbit polyclonal Cobl-Like 1 antibody raised against the N terminal of COBLL1
Product Categories/Family for anti-COBLL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
128 kDa (MW of target protein)
NCBI Official Full Name
cordon-bleu protein-like 1 isoform 1
NCBI Official Synonym Full Names
cordon-bleu WH2 repeat protein-like 1
NCBI Official Symbol
COBLL1
NCBI Official Synonym Symbols
COBLR1
NCBI Protein Information
cordon-bleu protein-like 1
UniProt Protein Name
Cordon-bleu protein-like 1
UniProt Gene Name
COBLL1
UniProt Synonym Gene Names
KIAA0977
UniProt Entry Name
COBL1_HUMAN

Similar Products

Product Notes

The COBLL1 cobll1 (Catalog #AAA224239) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cobl-Like 1 antibody reacts with Human, Mouse, Rat, Dog and may cross-react with other species as described in the data sheet. AAA Biotech's Cobl-Like 1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the COBLL1 cobll1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cobl-Like 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.