Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46591_IHC10.jpg IHC (Immunohistochemistry) (Cofilin 2 was detected in paraffin-embedded sections of human prostatic cancer tissues using rabbit anti- Cofilin 2 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

Rabbit Cofilin 2 Polyclonal Antibody | anti-CFL2 antibody

Anti-Cofilin 2 Antibody

Average rating 0.0
No ratings yet
Gene Names
CFL2; NEM7
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen affinity purified.
Synonyms
Cofilin 2, Antibody; Anti-Cofilin 2 Antibody; CFL 2; CFL2; CFL-2; Cofilin 2 muscle; Cofilin; Cofilin muscle; Cofilin2; Cofilin 2; Cofilin-2; NEM 7; NEM7; Q9Y281; cofilin 2; anti-CFL2 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Sequence Length
149
Applicable Applications for anti-CFL2 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Cofilin 2 (121-153aa KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL), identical to the related mouse sequence.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Cofilin 2 was detected in paraffin-embedded sections of human prostatic cancer tissues using rabbit anti- Cofilin 2 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46591_IHC10.jpg IHC (Immunohistochemistry) (Cofilin 2 was detected in paraffin-embedded sections of human prostatic cancer tissues using rabbit anti- Cofilin 2 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohistochemisry)

(Cofilin 2 was detected in paraffin-embedded sections of rat skeletal muscle tissues using rabbit anti- Cofilin 2 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46591_IHC11.jpg IHC (Immunohistochemisry) (Cofilin 2 was detected in paraffin-embedded sections of rat skeletal muscle tissues using rabbit anti- Cofilin 2 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

IHC (Immunohiostchemistry)

(Cofilin 2 was detected in paraffin-embedded sections of mouse cardiac muscle tissues using rabbit anti- Cofilin 2 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

product-image-AAA46591_IHC13.jpg IHC (Immunohiostchemistry) (Cofilin 2 was detected in paraffin-embedded sections of mouse cardiac muscle tissues using rabbit anti- Cofilin 2 Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.)

WB (Western Blot)

(Western blot analysis of Cofilin 2 expression in rat liver extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). Cofilin 24 at 19KD was detected using rabbit anti- Cofilin 2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)

product-image-AAA46591_WB15.jpg WB (Western Blot) (Western blot analysis of Cofilin 2 expression in rat liver extract (lane 1), mouse brain extract (lane 2) and HELA whole cell lysates (lane 3). Cofilin 24 at 19KD was detected using rabbit anti- Cofilin 2 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.)
Related Product Information for anti-CFL2 antibody
Rabbit IgG polyclonal antibody for Cofilin-2 (CFL2) detection.
Background: Cofilin 2 (muscle), also known as CFL2, is a protein which in humans is encoded by the CFL2 gene. It is mapped to 14q12. This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. And this protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.
References
1. "Entrez Gene: CFL2 cofilin 2 (muscle)".
2. Agrawal PB, Greenleaf RS, Tomczak KK, Lehtokari VL, Wallgren-Pettersson C, Wallefeld W, Laing NG, Darras BT, Maciver SK, Dormitzer PR, Beggs AH (January 2007). "Nemaline myopathy with minicores caused by mutation of the CFL2 gene encoding the skeletal muscle actin-binding protein, cofilin-2". Am. J. Hum. Genet. 80 (1): 162-7.
3. Gillett GT, Fox MF, Rowe PS, Casimir CM, Povey S (May 1996). "Mapping of human non-muscle type cofilin (CFL1) to chromosome 11q13 and muscle-type cofilin (CFL2) to chromosome 14". Ann. Hum. Genet. 60 (Pt 3): 201-11.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
– Da
NCBI Official Full Name
cofilin-2 isoform 2
NCBI Official Synonym Full Names
cofilin 2
NCBI Official Symbol
CFL2
NCBI Official Synonym Symbols
NEM7
NCBI Protein Information
cofilin-2
UniProt Protein Name
Cofilin-2
UniProt Gene Name
CFL2
UniProt Entry Name
COF2_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CFL2 cfl2 (Catalog #AAA46591) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Cofilin 2 Antibody reacts with Human, Mouse, Rat No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's Cofilin 2 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CFL2 cfl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cofilin 2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.