WB (Western Blot)
(Collagen Type IV alpha 3 antibody (AAA108380) used at 1 ug/ml to detect target protein.)
Rabbit Collagen Type IV alpha 3 Polyclonal Antibody | anti-COL4A3 antibody
Collagen Type IV alpha 3 antibody
Reactivity
Reacts with: HumanPredicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat.
Applications
Immunoprecipitation, Western Blot
Purity
Affinity purified
Synonyms
Collagen Type IV alpha 3, Antibody; Collagen Type IV alpha 3 antibody; Polyclonal Collagen Type IV alpha 3; Anti-Collagen Type IV alpha 3; CERT; Arresten; CERTL; Canstatin; COL4A3BP; FLJ20597; STARD11; Goodpasture Antigen Binding Protein; GPBP; Collagen Of Basement Membrane Alpha 3 Chain; anti-COL4A3 antibody
Host
Rabbit
Reactivity
Reacts with: Human
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat.
Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat.
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Purified antibody supplied as a liquid in PBS, with 0.09% NaN3 and 2% Sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence Length
199
Applicable Applications for anti-COL4A3 antibody
IP (Immunoprecipitation), WB (Western Blot)
Biological Significance
This gene encodes a kinase that specifically phosphorylates the N-terminal region of the non-collagenous domain of the alpha 3 chain of type IV collagen, known as the Goodpasture antigen. Goodpasture disease is the result of an autoimmune response directed at this antigen. One isoform of this protein is also involved in ceramide intracellular transport. Two transcripts exist for this gene.
Cross-Reactivity
Human
Immunogen
Collagen Type IV alpha 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPVERCGVLSKWTNYIHGWQDRWVVLKNNALSYYKSEDETEYGCRGSICL
Preparation and Storage
4 degree C short term, -20 degree C long term. Avoid repeat freeze-thaws.
WB (Western Blot)
(Collagen Type IV alpha 3 antibody (AAA108380) used at 1 ug/ml to detect target protein.)
WB (Western Blot)
(Collagen Type IV alpha 3 antibody (AAA108380) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-COL4A3 antibody
Rabbit polyclonal Collagen Type IV alpha 3 antibody
Product Categories/Family for anti-COL4A3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
68 kDa (MW of target protein)
NCBI Official Full Name
collagen type IV alpha 3, partial
NCBI Official Synonym Full Names
collagen, type IV, alpha 3 (Goodpasture antigen)
NCBI Official Symbol
COL4A3
NCBI Protein Information
collagen alpha-3(IV) chain
UniProt Protein Name
Collagen alpha-3(IV) chain
UniProt Gene Name
COL4A3
UniProt Entry Name
CO4A3_HUMAN
Similar Products
Product Notes
The COL4A3 col4a3 (Catalog #AAA108380) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Collagen Type IV alpha 3 antibody reacts with Reacts with: Human Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Mouse, Rabbit, Rat. and may cross-react with other species as described in the data sheet. AAA Biotech's Collagen Type IV alpha 3 can be used in a range of immunoassay formats including, but not limited to, IP (Immunoprecipitation), WB (Western Blot). Researchers should empirically determine the suitability of the COL4A3 col4a3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Collagen Type IV alpha 3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.