Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA46487_IHC10.jpg IHC (Immunohistochemistry) (Anti- CSNK1A1 Picoband antibody, AAA46487,IHC(P)IHC(P): Human Intestinal Cancer Tissue)

CSNK1A1 Polyclonal Antibody | anti-CSNK1A1 antibody

Anti-CSNK1A1 Antibody

Gene Names
CSNK1A1; CK1; CK1a; CKIa; HLCDGP1; PRO2975; HEL-S-77p
Reactivity
Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Immunogen Affinity Purified
Synonyms
CSNK1A1, Antibody; Anti-CSNK1A1 Antibody; Casein kinase I isoform alpha; Casein kinase 1 alpha 1; CK1; CK1A; CKI alpha; CKI-alpha; CKIa; Clock regulator kinase; Csnk1a1; Down regulated in lung cancer; HLCDGP1; KC1A_HUMAN; PRO2975; casein kinase 1, alpha 1; anti-CSNK1A1 antibody
Ordering
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
365
Applicable Applications for anti-CSNK1A1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human CSNK1A1 (30-68aa DIYLAINITNGEEVAVKLESQKARHPQLLYESKLYKILQ), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

IHC (Immunohistochemistry)

(Anti- CSNK1A1 Picoband antibody, AAA46487,IHC(P)IHC(P): Human Intestinal Cancer Tissue)

product-image-AAA46487_IHC10.jpg IHC (Immunohistochemistry) (Anti- CSNK1A1 Picoband antibody, AAA46487,IHC(P)IHC(P): Human Intestinal Cancer Tissue)

IHC (Immunohistochemisry)

(Anti- CSNK1A1 Picoband antibody, AAA46487,IHC(P)IHC(P): Rat Intestine Tissue)

product-image-AAA46487_IHC11.jpg IHC (Immunohistochemisry) (Anti- CSNK1A1 Picoband antibody, AAA46487,IHC(P)IHC(P): Rat Intestine Tissue)

IHC (Immunohiostchemistry)

(Anti- CSNK1A1 Picoband antibody, AAA46487,IHC(P)IHC(P): Mouse Intestine Tissue)

product-image-AAA46487_IHC13.jpg IHC (Immunohiostchemistry) (Anti- CSNK1A1 Picoband antibody, AAA46487,IHC(P)IHC(P): Mouse Intestine Tissue)

WB (Western Blot)

(Anti- CSNK1A1 Picoband antibody, AAA46487, Western blottingAll lanes: Anti CSNK1A1 (AAA46487) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Mouse Kidney Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 39KDObserved bind size: 39KD)

product-image-AAA46487_WB15.jpg WB (Western Blot) (Anti- CSNK1A1 Picoband antibody, AAA46487, Western blottingAll lanes: Anti CSNK1A1 (AAA46487) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Kidney Tissue Lysate at 50ugLane 3: Mouse Kidney Tissue Lysate at 50ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 39KDObserved bind size: 39KD)
Related Product Information for anti-CSNK1A1 antibody
Description: Rabbit IgG polyclonal antibody for Casein kinase I isoform alpha(CSNK1A1) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Casein kinase I isoform alpha is an enzyme that in humans is encoded by the CSNK1A1 gene. The CSNK1A1 gene is mapped to chromosome 5q32 based on an alignment of the CSNK1A1 sequence with the genomic sequence (GRCh37). It is reported that both screens identified CK1-alpha as a bifunctional regulator of NF-kappa-B. CK1-alpha dynamically associates with the CBM complex on T cell receptor engagement to participate in cytokine production and lymphocyte proliferation. However, CK1-alpha kinase activity has a contrasting role by subsequently promoting the phosphorylation and inactivation of CARMA1. CK1-alpha has thus a dual 'gating' function which first promotes and then terminates receptor-induced NF-kappa-B. ABC DLBCL cells required CK1-alpha for constitutive NF-kappa-B activity, indicating that CK1-alpha functions as a conditionally essential malignancy gene. 
References
1. Bidere, N., Ngo, V. N., Lee, J., Collins, C., Zheng, L., Wan, F., Davis, R. E., Lenz, G., Anderson, D. E., Arnoult, D., Vazquez, A., Sakai, K., Zhang, J., Meng, Z., Veenstra, T. D., Staudt, L. M., Lenardo, M. J. Casein kinase 1-alpha governs antigen-receptor-induced NF-kappa-B activation and human lymphoma cell survival. Nature 458: 92-96, 2009. 2. Elyada, E., Pribluda, A., Goldstein, R. E., Morgenstern, Y., Brachya, G., Cojocaru, G., Snir-Alkalay, I., Burstain, I., Haffner-Krausz, R., Jung, S., Wiener, Z., Alitalo, K., Oren, M., Pikarsky, E., Ben-Neriah, Y. CKI-alpha ablation highlights a critical role for p53 in invasiveness control. Nature 470: 409-413, 2011. 3. Tapia C, Featherstone T, Gómez C, Taillon-Miller P, Allende CC, Allende JE (Aug 1994). "Cloning and chromosomal localization of the gene coding for human protein kinase CK1". FEBS Letters 349 (2): 307-12.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,567 Da
NCBI Official Full Name
casein kinase I isoform alpha isoform 1
NCBI Official Synonym Full Names
casein kinase 1 alpha 1
NCBI Official Symbol
CSNK1A1
NCBI Official Synonym Symbols
CK1; CK1a; CKIa; HLCDGP1; PRO2975; HEL-S-77p
NCBI Protein Information
casein kinase I isoform alpha
UniProt Protein Name
Casein kinase I isoform alpha
UniProt Gene Name
CSNK1A1
UniProt Synonym Gene Names
CKI-alpha
UniProt Entry Name
KC1A_HUMAN

Similar Products

Product Notes

The CSNK1A1 csnk1a1 (Catalog #AAA46487) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-CSNK1A1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CSNK1A1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CSNK1A1 csnk1a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CSNK1A1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.