Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA163126_IHC11.jpg IHC (Immunohistochemisry) (CSNK1A1/CK1 Alpha Antibody-Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE))

Rabbit CSNK1A1/CK1 Alpha Polyclonal Antibody | anti-CSNK1A1 antibody

CSNK1A1/CK1 Alpha Rabbit anti-Human Polyclonal (aa100-200) Antibody

Average rating 0.0
No ratings yet
Gene Names
CSNK1A1; CK1; CK1a; CKIa; HLCDGP1; PRO2975; HEL-S-77p
Reactivity
Mouse, Rat, Human
Applications
Western Blot, Immunohistochemistry, Immunofluorescence
Purity
Affinity purified
Synonyms
CSNK1A1/CK1 Alpha, Antibody; CSNK1A1/CK1 Alpha Rabbit anti-Human Polyclonal (aa100-200) Antibody; IHC-plus CSNK1A1/CK1 Alpha Antibody (aa100-200); CSNK1A1; CK1 alpha; CK1a; CK1alpha; Clock regulator kinase; CK1; Casein kinase 1 alpha; CKIa; CKIalpha; Down-regulated in lung cancer; HLCDGP1; PRO2975; Casein kinase 1; alpha 1; Casein kinase I alpha; Casein kinase I isoform alpha; CKI-alpha; anti-CSNK1A1 antibody
Ordering
Host
Rabbit
Reactivity
Mouse, Rat, Human
Clonality
Polyclonal
Isotype
IgG
Specificity
LFNFCSRRFTMKTVLMLADQMISRIEYVHTKNFIHRDIKPDNFLMGIGRHCNKCLESPVGKRKRSMTVSTSQDPSFSGLNQLFLIDFGLAKKYRDNRTRQH
Purity/Purification
Affinity purified
Form/Format
PBS, pH7.3, 0.02% Sodium Azide, 50% Glycerol
Applicable Applications for anti-CSNK1A1 antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence)
Target
Human CSNK1A1/CK1 Alpha
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human CSNK1A1 (NP_001020276.1).
Conjugation
Unconjugated
Epitope
aa100-200
Family
Protein Kinase
Subfamily
Casein kinase I
Preparation and Storage
Store at -20 degree C. Avoid freeze-thaw cycles.

IHC (Immunohistochemisry)

(CSNK1A1/CK1 Alpha Antibody-Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA163126_IHC11.jpg IHC (Immunohistochemisry) (CSNK1A1/CK1 Alpha Antibody-Human Kidney: Formalin-Fixed, Paraffin-Embedded (FFPE))

IHC (Immunohiostchemistry)

(CSNK1A1/CK1 Alpha Antibody-Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE))

product-image-AAA163126_IHC13.jpg IHC (Immunohiostchemistry) (CSNK1A1/CK1 Alpha Antibody-Human Small Intestine: Formalin-Fixed, Paraffin-Embedded (FFPE))

WB (Western Blot)

(CSNK1A1/CK1 Alpha Antibody-Western blot-CSNK1A1 Polyclonal Antibody)

product-image-AAA163126_WB15.jpg WB (Western Blot) (CSNK1A1/CK1 Alpha Antibody-Western blot-CSNK1A1 Polyclonal Antibody)
Related Product Information for anti-CSNK1A1 antibody
CK1 Alpha antibody is an unconjugated rabbit polyclonal antibody to CK1 Alpha (CSNK1A1)(aa100-200) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB. Tested on 20 paraffin-embedded human tissues.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37,567 Da
NCBI Official Full Name
casein kinase I isoform alpha isoform 2
NCBI Official Synonym Full Names
casein kinase 1 alpha 1
NCBI Official Symbol
CSNK1A1
NCBI Official Synonym Symbols
CK1; CK1a; CKIa; HLCDGP1; PRO2975; HEL-S-77p
NCBI Protein Information
casein kinase I isoform alpha
UniProt Protein Name
Casein kinase I isoform alpha
UniProt Gene Name
CSNK1A1
UniProt Synonym Gene Names
CKI-alpha
UniProt Entry Name
KC1A_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The CSNK1A1 csnk1a1 (Catalog #AAA163126) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CSNK1A1/CK1 Alpha Rabbit anti-Human Polyclonal (aa100-200) Antibody reacts with Mouse, Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's CSNK1A1/CK1 Alpha can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence). Researchers should empirically determine the suitability of the CSNK1A1 csnk1a1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CSNK1A1/CK1 Alpha, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.