Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA197367_WB10.jpg WB (Western Blot) (WB Suggested Anti-CTBP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateCTBP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit CTBP1 Polyclonal Antibody | anti-CTBP1 antibody

CTBP1 antibody - C-terminal region

Gene Names
CTBP1; BARS; HADDTS
Reactivity
Dog, Horse, Human, Mouse, Pig, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
CTBP1, Antibody; CTBP1 antibody - C-terminal region; anti-CTBP1 antibody
Ordering
Host
Rabbit
Reactivity
Dog, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL
Sequence Length
440
Applicable Applications for anti-CTBP1 antibody
IHC (Immunohistochemistry), WB (Western Blot)
Homology
Dog: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human CTBP1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

WB (Western Blot)

(WB Suggested Anti-CTBP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateCTBP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

product-image-AAA197367_WB10.jpg WB (Western Blot) (WB Suggested Anti-CTBP1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateCTBP1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

WB (Western Blot)

(Host: MouseTarget Name: CTBP1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

product-image-AAA197367_WB11.jpg WB (Western Blot) (Host: MouseTarget Name: CTBP1Sample Tissue: Mouse BrainAntibody Dilution: 1ug/ml)

IHC (Immunohiostchemistry)

(Human Pancreas)

product-image-AAA197367_IHC13.jpg IHC (Immunohiostchemistry) (Human Pancreas)

IHC (Immunohistochemistry)

(CTBP1 antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasm and nucleus in Human Pineal TissuePrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

product-image-AAA197367_IHC15.jpg IHC (Immunohistochemistry) (CTBP1 antibody - C-terminal regionFormalin Fixed Paraffin Embedded Tissue: Human Pineal TissueObserved Staining: Cytoplasm and nucleus in Human Pineal TissuePrimary Antibody Concentration: 1:100Other Working Concentrations: 1/600Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-CTBP1 antibody
This is a rabbit polyclonal antibody against CTBP1. It was validated on Western Blot and immunohistochemistry

Target Description: The phosphoprotein C-terminal binding protein 1 (CTBP-1) binds the C-terminus of adenovirus E1A protein. CTBP-1 is a transcriptional repressor and may play a role during cellular proliferation. A second closely related gene, CTBP2, maps to chromosome 21.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48kDa
NCBI Official Full Name
C-terminal-binding protein 1 isoform 2
NCBI Official Synonym Full Names
C-terminal binding protein 1
NCBI Official Symbol
CTBP1
NCBI Official Synonym Symbols
BARS; HADDTS
NCBI Protein Information
C-terminal-binding protein 1
UniProt Protein Name
C-terminal-binding protein 1
UniProt Gene Name
CTBP1
UniProt Synonym Gene Names
CTBP; CtBP1
UniProt Entry Name
CTBP1_HUMAN

Similar Products

Product Notes

The CTBP1 ctbp1 (Catalog #AAA197367) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CTBP1 antibody - C-terminal region reacts with Dog, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CTBP1 can be used in a range of immunoassay formats including, but not limited to, IHC (Immunohistochemistry), WB (Western Blot). Researchers should empirically determine the suitability of the CTBP1 ctbp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TGIPAAVEGI VPSAMSLSHG LPPVAHPPHA PSPGQTVKPE ADRDHASDQL. It is sometimes possible for the material contained within the vial of "CTBP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.