Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282249_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat lung using Cullin 1 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

Rabbit anti-Mouse, Rat Cullin 1 Polyclonal Antibody | anti-MYD88 antibody

Cullin 1 Rabbit pAb

Average rating 0.0
No ratings yet
Gene Names
MYD88; MYD88D
Reactivity
Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
Cullin 1, Antibody; Cullin 1 Rabbit pAb; CUL1; MGC149834; MGC149835; cullin-1; anti-MYD88 antibody
Ordering
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.05% proclin300,50% glycerol,pH7.3.
Sequence
LPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPR
Applicable Applications for anti-MYD88 antibody
WB (Western Blot)
Positive Samples
Mouse brain, Rat brain
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 435-593 of human Cullin 1 (NP_003583.2).
Cellular Location
cytosol, nucleoplasm, plasma membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

IHC (Immunohistochemistry)

(Immunohistochemistry of paraffin-embedded rat lung using Cullin 1 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282249_IHC10.jpg IHC (Immunohistochemistry) (Immunohistochemistry of paraffin-embedded rat lung using Cullin 1 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohistochemisry)

(Immunohistochemistry of paraffin-embedded human lung cancer using Cullin 1 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282249_IHC11.jpg IHC (Immunohistochemisry) (Immunohistochemistry of paraffin-embedded human lung cancer using Cullin 1 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

IHC (Immunohiostchemistry)

(Immunohistochemistry of paraffin-embedded human colon using Cullin 1 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

product-image-AAA282249_IHC13.jpg IHC (Immunohiostchemistry) (Immunohistochemistry of paraffin-embedded human colon using Cullin 1 Rabbit pAb at dilution of 1:50 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.)

WB (Western Blot)

(Western blot analysis of various lysates, using CUL1 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)

product-image-AAA282249_WB15.jpg WB (Western Blot) (Western blot analysis of various lysates, using CUL1 antibody at 1:500 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 30s.)
Related Product Information for anti-MYD88 antibody
The cullin family proteins are scaffold proteins for the Ring finger type E3 ligases. Humans express seven cullin proeins: CUL1 -3, CUL4A, CUL4B, CUL5, and CUL7. Each cullin protein can form an E3 ligase similar to the prototype Ring-type E3 ligase Skp1-CUL1-F-box complex. The Cullin-RING-finger type E3 ligases are important regulators in early embryonic development, as highlighted by genetic studies demonstrating that knock-out of CUL1, CUL3, or CUL4A in mice results in early embryonic lethality.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
296 (309)
NCBI Official Full Name
myeloid differentiation primary response protein MyD88 isoform 5
NCBI Official Synonym Full Names
myeloid differentiation primary response 88
NCBI Official Symbol
MYD88
NCBI Official Synonym Symbols
MYD88D
NCBI Protein Information
myeloid differentiation primary response protein MyD88; myeloid differentiation primary response gene (88)
UniProt Protein Name
Myeloid differentiation primary response protein MyD88
UniProt Gene Name
MYD88
UniProt Entry Name
MYD88_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The MYD88 myd88 (Catalog #AAA282249) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cullin 1 Rabbit pAb reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Cullin 1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the MYD88 myd88 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LPLAALNMRV RRRLSLFLNV RTQVAADWTA LAEEMDFEYL EIRQLETQAD PTGRLLDAWQ GRPGASVGRL LELLTKLGRD DVLLELGPSI EEDCQKYILK QQQEEAEKPL QVAAVDSSVP R. It is sometimes possible for the material contained within the vial of "Cullin 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.