Rabbit Cyclin B1 Polyclonal Antibody | anti-CCNB1 antibody
Cyclin B1 Polyclonal Antibody
Gene Names
CCNB1; CCNB
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Purity
Affinity Purification
Synonyms
Cyclin B1, Antibody; Cyclin B1 Polyclonal Antibody; CCNB1 Polyclonal Antibody; CCNB1; CCNB; cyclin B1; anti-CCNB1 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.42 mg/ml (varies by lot)
Sequence Length
433
Applicable Applications for anti-CCNB1 antibody
WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), IP (Immunoprecipitation)
Application Notes
WB: 1:500-1:2000
IHC: 1:50-1:200
IF: 1:50-1:200
IP: 1:50-1:100
IHC: 1:50-1:200
IF: 1:50-1:200
IP: 1:50-1:100
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 330 to the C-terminus of human Cyclin B1 (NP_114172.1).
Immunogen Sequence
TMLDYDMVHFPPSQIAAGAFCLALKILDNGEWTPTLQHYLSYTEESLLPVMQHLAKNVVMVNQGLTKHMTVKNKYATSKHAKISTLPQLNSALVQDLAKAVAKV
Positive Samples
NIH/3T3, Rat Spleen, Rat Thymus
Cellular Location
Cytoplasm, Nucleus, Centrosome, Cytoskeleton, Microtubule Organizing Center
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Related Product Information for anti-CCNB1 antibody
The protein encoded by this gene is a regulatory protein involved in mitosis. The gene product complexes with p34(cdc2) to form the maturation-promoting factor (MPF). Two alternative transcripts have been found, a constitutively expressed transcript and a cell cycle-regulated transcript, that is expressed predominantly during G2/M phase. The different transcripts result from the use of alternate transcription initiation sites.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 44kDa; 48kDa
Observed: 55kDa
Observed: 55kDa
NCBI Official Full Name
G2/mitotic-specific cyclin-B1 isoform 1
NCBI Official Synonym Full Names
cyclin B1
NCBI Official Symbol
CCNB1
NCBI Official Synonym Symbols
CCNB
NCBI Protein Information
G2/mitotic-specific cyclin-B1
UniProt Protein Name
G2/mitotic-specific cyclin-B1
UniProt Gene Name
CCNB1
UniProt Synonym Gene Names
CCNB
UniProt Entry Name
CCNB1_HUMAN
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The CCNB1 ccnb1 (Catalog #AAA28291) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cyclin B1 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Cyclin B1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot), IHC (Immunohistochemistry), IF (Immunofluorescence), IP (Immunoprecipitation). WB: 1:500-1:2000 IHC: 1:50-1:200 IF: 1:50-1:200 IP: 1:50-1:100. Researchers should empirically determine the suitability of the CCNB1 ccnb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cyclin B1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
