WB (Western Blot)
(WB Suggested Anti-DACT1 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellHuman HepG2)
Rabbit DACT1 Polyclonal Antibody | anti-DACT1 antibody
DACT1 antibody - C-terminal region
Gene Names
DACT1; DPR1; TBS2; FRODO; HDPR1; DAPPER; THYEX3; DAPPER1
Reactivity
Tested||HumanPredicted||Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DACT1, Antibody; DACT1 antibody - C-terminal region; anti-DACT1 antibody
Host
Rabbit
Reactivity
Tested||Human
Predicted||Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Predicted||Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: PLPYASPYAYVASDSEYSAECESLFHSTVVDTSEDEQSNYTTNCFGDSES
Sequence Length
799
Applicable Applications for anti-DACT1 antibody
WB (Western Blot)
Predicted Homology
Cow: 92%; Dog: 92%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
Protien Size (#AA)
799 amino acids
Protein Interactions
BECN1; PIK3C3; ATG14; CBX6; PPP1CC; Dact1; Dact3; C7orf25; TK1; SH3GL2; CSNK2B; LEF1; HDAC1;
Blocking Peptide
For anti-DACT1 (MBS3215888) antibody is Catalog # (MBS3240790)
Preparation and Storage
For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles.
WB (Western Blot)
(WB Suggested Anti-DACT1 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellHuman HepG2)
WB (Western Blot)
(WB Suggested Anti-DACT1 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole CellHuman HepG2)
Related Product Information for anti-DACT1 antibody
Target Description: DACT1 positively regulates DVL2-mediated signaling pathways during development. It binds to DVL2 and impedes the degradation of CTNNB1/beta-catenin, thereby enhancing the transcriptional activation of target genes of the Wnt signaling pathway.
Product Categories/Family for anti-DACT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
86kDa
NCBI Official Full Name
dapper homolog 1 isoform 2
NCBI Official Synonym Full Names
dishevelled binding antagonist of beta catenin 1
NCBI Official Symbol
DACT1
NCBI Official Synonym Symbols
DPR1; TBS2; FRODO; HDPR1; DAPPER; THYEX3; DAPPER1
NCBI Protein Information
dapper homolog 1
Similar Products
Product Notes
The DACT1 (Catalog #AAA201161) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DACT1 antibody - C-terminal region reacts with Tested||Human Predicted||Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DACT1 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DACT1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PLPYASPYAY VASDSEYSAE CESLFHSTVV DTSEDEQSNY TTNCFGDSES. It is sometimes possible for the material contained within the vial of "DACT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.