Rabbit DEPDC7 Polyclonal Antibody | anti-DEPDC7 antibody
DEPDC7 antibody - N-terminal region
Gene Names
DEPDC7; TR2; dJ85M6.4
Reactivity
Tested Species Reactivity: HumanPredicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DEPDC7, Antibody; DEPDC7 antibody - N-terminal region; anti-DEPDC7 antibody
Host
Rabbit
Reactivity
Tested Species Reactivity: Human
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
0.5 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: FGKDKKPTFEDSSCSLYRFTTIPNQDSQLGKENKLYSPARYADALFKSSD
Sequence Length
502
Applicable Applications for anti-DEPDC7 antibody
WB (Western Blot)
Homology
Cow: 92%; Dog: 100%; Guinea Pig: 91%; Horse: 92%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 92%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DEPDC7
Protein Size (# AA)
502 amino acids
Protein Interactions
GTF2B; ISG15; UBC;
Blocking Peptide
For anti-DEPDC7 (MBS3210388) antibody is Catalog #
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Related Product Information for anti-DEPDC7 antibody
Target Description: The exact function of DEPDC7 remains unknown.
Product Categories/Family for anti-DEPDC7 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
58
NCBI Official Full Name
DEP domain-containing protein 7 isoform 2
NCBI Official Synonym Full Names
DEP domain containing 7
NCBI Official Symbol
DEPDC7
NCBI Official Synonym Symbols
TR2; dJ85M6.4
NCBI Protein Information
DEP domain-containing protein 7
UniProt Protein Name
DEP domain-containing protein 7
UniProt Gene Name
DEPDC7
Customer Reviews
Loading reviews...
Share Your Experience
Similar Products
Product Notes
The DEPDC7 depdc7 (Catalog #AAA200171) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DEPDC7 antibody - N-terminal region reacts with Tested Species Reactivity: Human Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's DEPDC7 can be used in a range of immunoassay formats including, but not limited to, WB (Western Blot). Researchers should empirically determine the suitability of the DEPDC7 depdc7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGKDKKPTFE DSSCSLYRFT TIPNQDSQLG KENKLYSPAR YADALFKSSD. It is sometimes possible for the material contained within the vial of "DEPDC7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
