Loading...

Skip to main content
Call us at +1-800-604-9114 for more information about our products or contact us online Need help? +1-800-604-9114 or contact us
product-image-AAA282277_CHIP10.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation analysis of extracts of Jurkat cells, using DNMT1 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

Rabbit anti-Human DNMT1 Polyclonal Antibody | anti-DNMT1 antibody

DNMT1 Rabbit pAb

Average rating 0.0
No ratings yet
Reactivity
Human
Applications
Chromatin Immunoprecipitation, Immunoprecipitation, Immunoprecipitation, Immunocytochemistry, Immunofluorescence, Western Blot
Purity
Affinity purification
Synonyms
DNMT1, Antibody; DNMT1 Rabbit pAb; DNMT1; ADCADN; AIM; CXXC9; DNMT; HSN1E; MCMT; m.HsaI; DNA methyltransferase 1; anti-DNMT1 antibody
Ordering
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
SNTQAERSIIGMIDMFHKYTRRDDKIEKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLGDIATDYHKQSHGAAPCSGGSQ
Applicable Applications for anti-DNMT1 antibody
ChIP (Chromatin immunoprecipitation), IP (Immunoprecipitation), ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1417-1616 of human DNMT1 (NP_001370.1).
Cellular Location
Nucleus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

ChIP (Chromatin Immunoprecipitation)

(Chromatin immunoprecipitation analysis of extracts of Jurkat cells, using DNMT1 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

product-image-AAA282277_CHIP10.jpg ChIP (Chromatin Immunoprecipitation) (Chromatin immunoprecipitation analysis of extracts of Jurkat cells, using DNMT1 antibody and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.)

IP (Immunoprecipitation)

(Immunoprecipitation analysis of 300ug extracts of Jurkat cells using 3ug DNMT1 antibody. Western blot was performed from the immunoprecipitate using DNMT1 at a dilution of 1:1000.)

product-image-AAA282277_IP11.jpg IP (Immunoprecipitation) (Immunoprecipitation analysis of 300ug extracts of Jurkat cells using 3ug DNMT1 antibody. Western blot was performed from the immunoprecipitate using DNMT1 at a dilution of 1:1000.)

IF (Immunofluorescence)

(Immunofluorescence analysis of 293T cells using DNMT1 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

product-image-AAA282277_IF13.jpg IF (Immunofluorescence) (Immunofluorescence analysis of 293T cells using DNMT1 antibody at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.)

WB (Western Blot)

(Western blot analysis of extracts of various cell lines, using DNMT1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)

product-image-AAA282277_WB15.jpg WB (Western Blot) (Western blot analysis of extracts of various cell lines, using DNMT1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.)
Related Product Information for anti-DNMT1 antibody
This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found in human tumors and associated with developmental abnormalities. Variation in this gene has been associated with cerebellar ataxia, deafness, and narcolepsy, and neuropathy, hereditary sensory, type IE. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
UniProt Accession #
Molecular Weight
11,471 Da
NCBI Official Full Name
S100A7
UniProt Protein Name
Protein S100-A7
UniProt Gene Name
S100A7
UniProt Synonym Gene Names
PSOR1; S100A7C
UniProt Entry Name
S10A7_HUMAN

Customer Reviews

View All Reviews

Loading reviews...

Share Your Experience

Rating

Similar Products

Product Notes

The DNMT1 s100a7 (Catalog #AAA282277) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DNMT1 Rabbit pAb reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DNMT1 can be used in a range of immunoassay formats including, but not limited to, ChIP (Chromatin immunoprecipitation), IP (Immunoprecipitation), ICC (Immunocytochemistry), IF (Immunofluorescence), WB (Western Blot). Researchers should empirically determine the suitability of the DNMT1 s100a7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SNTQAERSII GMIDMFHKYT RRDDKIEKPS LLTMMKENFP NFLSACDKKG TNYLADVFEK KDKNEDKKID FSEFLSLLGD IATDYHKQSH GAAPCSGGSQ. It is sometimes possible for the material contained within the vial of "DNMT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Submit a Question

Please complete the form below and a representative will contact you as soon as possible.

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.